Conserved Protein Domain Family
IgI_3_WFIKKN-like

?
cd05765: IgI_3_WFIKKN-like 
Third immunoglobulin-like domain of the human WFIKKN (WAP, follistatin, immunoglobulin, Kunitz and NTR domain-containing protein), and similar domains; member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the third immunoglobulin-like domain of the human WFIKKN (WAP, follistatin, immunoglobulin, Kunitz and NTR domain-containing protein) and similar proteins. WFIKKN is a secreted protein that consists of multiple types of protease inhibitory modules, including two tandem Kunitz-type protease inhibitor-domains. The Ig superfamily is a heterogenous group of proteins built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond. This group belongs to the I-set of IgSF domains, having A-B-E-D strands in one beta-sheet and A'-G-F-C-C' in the other. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.
Statistics
?
PSSM-Id: 409422
View PSSM: cd05765
Aligned: 4 rows
Threshold Bit Score: 182.749
Threshold Setting Gi: 47208267
Created: 17-Aug-2007
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1     ####                                                                            
Q96NZ8    186 PALYSSPSPQAVQVGGTASLHCDVSGRPPPAVTWEKQSHQ-RENLIMRPDQMYGNVVVTSIGQLVLYNARPEDAGLYTCT 264 human
CAF91949  204 PLIHVSPTHQTVKAGETASFLCDVTGHPQPEITWEKHLPDgEERLVLTPNHVRGNMVVTNIGQLVIYNAQPRDSGLYTCT 283 Tetraodon nigrovir...
AAH94175   21 PTLVNNPFEKMVDVGDTVSFHCDVTGKPMPEITWEKQVDG-KENVIMRPNHVVANIVVTNIAQLVIYNTQLQDAGIYTCT 99  African clawed frog
XP_420100 207 PALVNNPVHQSVYVGETVSFLCDVTGRPKPEITWEKQVEG-KEKVIMKPNHVRGNVVVTNIAQLVIYNTQLQDAGIYTCT 285 chicken
Feature 1                     
Q96NZ8    265 ARNAAGLLRADFPLSV 280 human
CAF91949  284 AQNPSGSVQANHPLTV 299 Tetraodon nigroviridis
AAH94175  100 AMNSGGVIKVNFPLSV 115 African clawed frog
XP_420100 286 ARNSGGLLRADFPLSV 301 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap