2C5D,1RHF


Conserved Protein Domain Family
IgI_2_Axl_Tyro3_like

?
cd05749: IgI_2_Axl_Tyro3_like 
Second immunoglobulin (Ig)-like domain of Axl/Tyro3 family receptor tyrosine kinases (RTKs); member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3, and Mer are widely expressed in adult tissues, though they show higher expression in the brain, lymphatic and vascular systems, and testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and cell proliferation.
Statistics
?
PSSM-Id: 409407
View PSSM: cd05749
Aligned: 8 rows
Threshold Bit Score: 145.301
Threshold Setting Gi: 47221063
Created: 27-Sep-2007
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:2C5D_C, human receptor tyrosine kinase Tyro3 binds its activator Gas6 defined by 3.5A distance.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                 ### #  
2C5D_C       108 YFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAp--gHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSR 185  human
1RHF_A       100 FFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKIGGP----APSPSVLNVTGVTQSTXFSCEAHNLKGLASSR 175  human
NP_990319    188 HFIQQPEKLNVTRNSPFNLTCQAVGPPEPVEIYWFRNNVQLNMKp---YISPSVLTVPGLNETALFSCEAHNSKGLTASN 264  chicken
CAG12757     105 HFSVEPQHMSVEANVSLSLSCVAHGPPEPVRVIWLQDGAPLNALtdpvALSPSTLNLTGLNRTSTFSCEAQNHKGVATSA 184  Tetraodon nigr...
CAM73158     118 HFGVEPEDVAAFAGESFNLTCAASGPPEPVEVLWWLGGEQNGDF----TPSPSVLFVKGVNESIKFHCEAKNARGISVSR 193  zebrafish
NP_001082223 126 YFTLEPKDLSVTPNSPFNMTCAAVGPPEPLVIIWWVGDSPLGKS----ESSPSVLQMSGIHERTAFSCEAHNAKGVSSSR 201  African clawed...
Q12866       198 HFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQp---EKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSK 274  human
XP_003121628 143 FFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGGTKVGGP----APSPSVLNVTGVTQSTEFSCEAHNLKGLASSR 218  Sus scrofa
Feature 1             
2C5D_C       186 TATIT 190  human
1RHF_A       176 TATVH 180  human
NP_990319    265 PGQVN 269  chicken
CAG12757     185 SGTIT 189  Tetraodon nigroviridis
CAM73158     194 TGTVH 198  zebrafish
NP_001082223 202 TAIVE 206  African clawed frog
Q12866       275 GVQIN 279  human
XP_003121628 219 PATVR 223  Sus scrofa

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap