Conserved Protein Domain Family
Ig4_Peroxidasin

?
cd05746: Ig4_Peroxidasin 
Fourth immunoglobulin (Ig)-like domain of peroxidasin
The members here are composed of the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death and protection of the organism against non-self.
Statistics
?
PSSM-Id: 143223
View PSSM: cd05746
Aligned: 5 rows
Threshold Bit Score: 148.484
Threshold Setting Gi: 118100719
Created: 31-Aug-2007
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
 
Feature 1:Ig strand B [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      #####                                                                
NP_036425  542 VQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTIGSASVSMVLS 610  human
XP_797821  523 IRLPCSASGDPEPLITWTKDGVQITESAKFSISEAGHLAIHDVGVDDDGRYECAARNTIGYASTDMELT 591  purple urchin
XP_419931  518 VQIPCSAQGEPEPVITWNKDGVQVTESGKFHVSPEGYLTIRDVGTADEGRYECVARNTIGYSSVSMVLS 586  chicken
AAI35156   532 VQIPCSSQGDPLPIITWNKDGIQVTESGKFHISPHGYLAIRDAGLADQGRYECVARNPIGYSSVSMVLS 600  western clawed frog
XP_417421  530 VAITCAAQGDPRPTITWVKEGIQITESGKFHVSQDGTLSIQDLGVADQGRYECIARNPFGFTSSAMQLT 598  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap