Conserved Protein Domain Family
Ig3_Peroxidasin

?
cd05745: Ig3_Peroxidasin 
Third immunoglobulin (Ig)-like domain of peroxidasin
The members here are composed of the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death and protection of the organism against non-self.
Statistics
?
PSSM-Id: 143222
View PSSM: cd05745
Aligned: 4 rows
Threshold Bit Score: 154.326
Threshold Setting Gi: 47215105
Created: 31-Aug-2007
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
 
Feature 1:Ig strand B [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #####                                                                 
AAI35156   436 EGHTVDFHCEAQGNPKPVIAWTKGGNQLSVDRRHQVLSSGTLRILRVALHDQGQYECQAVNIVGSKSTAAQLIV 509  western clawed frog
NP_036425  446 EGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTV 519  human
CAF98179   362 EGQTVDFLCEASGYPQPVIAWTRGGSPLPLDRRHVVLSSGALRITRVEAHDEGEYECQAVSPVGTVRTSAQLNI 435  Tetraodon nigroviridis
XP_419931  422 EGQTVDFPCEAQGYPQPVIAWTKGGGQLSVDRRHLVLSSGTLRISRVALHDQGQYECQAVNIIGSQRIVVYLTV 495  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap