5NOI


Conserved Protein Domain Family
IgI_4_Robo

?
cd05726: IgI_4_Robo 
Fourth immunoglobulin (Ig)-like domain in Robo (roundabout) receptors; member of the I-set of Ig superfamily (IgSF) domains
Members here are composed the fourth immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (Robo1, Robo2, Robo3), and three mammalian Slit homologs (Slit-1, Slit-2, Slit-3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. Robo1, Robo2, and Robo3 are expressed by commissural neurons in the vertebrate spinal cord and Slit-1, Slit-2, and Slit-3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of Slit responsiveness, antagonizes Slit responsiveness in precrossing axons. The Slit-Robo interaction is mediated by the second leucine-rich repeat (LRR) domain of Slit and the two N-terminal Ig domains of Robo, Ig1 and Ig2. The primary Robo binding site for Slit2 has been shown by surface plasmon resonance experiments and mutational analysis to be the Ig1 domain, while the Ig2 domain has been proposed to harbor a weak secondary binding site. This group belongs to the I-set of IgSF domains, having A-B-E-D strands in one beta-sheet and A'-G-F-C-C' in the other. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.
Statistics
?
PSSM-Id: 409391
View PSSM: cd05726
Aligned: 6 rows
Threshold Bit Score: 185.545
Threshold Setting Gi: 49036501
Created: 17-Aug-2007
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #####                                                                           
5NOI_A          5 QFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQAL 84   human
O89026        313 HFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTL 392  house mouse
XP_416673     383 QFVVKPRDQVAALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTL 462  chicken
NP_001084250  315 NFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWQKEGSQNLLFSYQPPQSSSRFSVSQTGDLTITTVQKSDVGYYICQTL 394  African clawe...
Q9Z2I4        348 QFVTKPQNQTVAPGANVSFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPMGRLLVSPRGQLNITEVKIGDGGYYVCQAV 427  house mouse
CAM60099      317 QFVIRPRDQIVAQGRTASFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRFSVSPSGDLTITAVQRADAGYYICQAL 396  zebrafish
Feature 1                           
5NOI_A         85 TVAGSILAKAQLEVTDVL 102  human
O89026        393 NVAGSIITKAYLEVTDVI 410  house mouse
XP_416673     463 NVAGSIITKAYLEVTDVI 480  chicken
NP_001084250  395 NVAGSITTKAFLEVTDVV 412  African clawed frog
Q9Z2I4        428 SVAGSILAKALLEIKGAS 445  house mouse
CAM60099      397 TVAGSILAKAQLEVTDVL 414  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap