2ARJ,1AKJ,2ATP


Conserved Protein Domain Family
IgV_CD8_alpha

?
cd05720: IgV_CD8_alpha 
Immunoglobulin (Ig)-like variable (V) domain of Cluster of Differentiation (CD) 8 alpha chain
The members here are composed of the immunoglobulin (Ig)-like variable domain of the Cluster of Differentiation (CD) 8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation, and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners, etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion, and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.
Statistics
?
PSSM-Id: 409385
View PSSM: cd05720
Aligned: 6 rows
Threshold Bit Score: 154.18
Threshold Setting Gi: 126305326
Created: 20-Sep-2007
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface [polypeptide binding site]
Evidence:
  • Structure:2ATP; mouse CD8 alpha forms a functional heterodimer with CD8 beta, defined using 3.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                     # #  #          #                  
2ARJ_R         7 LRIFPk-KMDAELGQKVDLVCEVLgs-vsQGCSWLFQNsssklpQPTFVVYMAsshnKITWDEklnsskLFSAMRDtnnK 84  house mouse
1AKJ_D         3 FRVSPl-DRTWNLGETVELKCQVLlsnptSGCSWLFQPrga-aaSPTFLLYLSq--nKPKAAEgld-tqRFSGKRLg-dT 76  human
2ATP_A         7 LRIFPk-KMDAELGQKVDLVCEVLgs-vsQGCSWLFQNsssklpQPTFVVYMAsshnKITWDEklnsskLFSAMRDtnnK 84  house mouse
AAQ73501      29 FRMSPr-ELVAQVGTKVTLRCEVLvpnapAGCSWLFQPrhd-akGPTFLLYHSa--sGTKLAPgle-qkRFSPSKSs-nT 102 domestic guinea...
ABA55041      10 ARFLNrnMKHPQEGQPLELECLPFni--dNGVSWIRQEkd---gKLHFIVYISpf-sRTTFPRnertssQFEGSKQg-sS 82  chicken
XP_001379394 213 FRMNPveKRDAGQGRELKLQCETVns-spTGCSWLRLTpg--avVPTFLLYLSgssqSVKVAPeld-srRFGGSRSs-sS 287 gray short-tail...
Feature 1                            #  #   #  #     
2ARJ_R        85 YVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQ 120 house mouse
1AKJ_D        77 FVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFL 112 human
2ATP_A        85 YVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQ 120 house mouse
AAQ73501     103 YTLTVNSFQKRDEGYYFCSVSGNMMLYFSPFVPVFL 138 domestic guinea pig
ABA55041      83 FRLVVKNFRAQDQGTYFCIANINQVLYFSSGQPAFF 118 chicken
XP_001379394 288 YFLTLKDFQKDDQGYYYCVVARNSRLFFSPFVPVFM 323 gray short-tailed opossum

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap