Conserved Protein Domain Family
STKc_LATS2

?
cd05626: STKc_LATS2 
Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with poor prognosis in acute lymphoblastic leukemia and breast cancer. The LATS2 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 173715
View PSSM: cd05626
Aligned: 3 rows
Threshold Bit Score: 838.514
Threshold Setting Gi: 169158211
Created: 5-Sep-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of peptide substrates and ATP analogs to the AGC kinases, PKA and PKB.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #####   #            # #                               #               #
Q9NRM7     666 SMFVKIKTLGIGAFGEVCLACKVDThALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVM 745  human
CAQ13338   706 SMFVKIKTLGIGAFGEVCLTRKVDTgALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVRLYYSFQDRDNLYFVM 785  zebrafish
XP_417143  705 SMFVKIKTLGIGAFGEVCLACKVDThALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKENLYFVM 784  chicken
Feature 1      # #   # #                                    # # ## #         ##  #             
Q9NRM7     746 DYIPGGDMMSLLIRMeVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYY 825  human
CAQ13338   786 DYIPGGDMMSLLIRMgVFPEVLARFYVAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYY 865  zebrafish
XP_417143  785 DYIPGGDMMSLLIRMeVFPERLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYY 864  chicken
Feature 1                                                     ######                          #
Q9NRM7     826 QKGSHVRQDSMEPSDLWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFE 905  human
CAQ13338   866 QKGNHIRQDSMEPSDFWDDVSNCRCGDRLMTLEQRATRQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFE 945  zebrafish
XP_417143  865 QKGSHIRQDSMEPSDLWDDVSNCRCGDRLKTLEQRAKKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFE 944  chicken
Feature 1           #  #                                                                       
Q9NRM7     906 MLVGQPPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLGrnGADDLKAHPFFSAIDFSSdIRKQ 985  human
CAQ13338   946 MLVGQPPFLAPTPTETQLKVINWENTLQVPPQVKLSPEAVDIIGQLCCSAEERLGgnGAGEIKAHPFFSEVDFSSnLRTQ 1025 zebrafish
XP_417143  945 MLVGQPPFLAPTPTETQLKVINWESTLHIPSQIKLSPEAADLITKLCCAAEDRLGrnGADDIKAHSFFHSMDFSTdIRRQ 1024 chicken
Feature 1                                                                     
Q9NRM7     986 PAPYVPTISHPMDTSNFDPVDEEspwnd--asegSTKAWDTLTSPNNKHPEHAFYEFTFRRFF 1046 human
CAQ13338  1026 PAPYRPKIAHPMDTSNFDPVEEEggpgawsdsgdSTRTWDTLCSPHGKHPEHAFYEFTFRRFF 1088 zebrafish
XP_417143 1025 PAPYVPKISHPMDTSNFDPVEEEspwnd--asgdSTRTWDPLASSNSKHTEHAFYEFTFRRFF 1085 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap