1O6K,2JDO,1MRY


Conserved Protein Domain Family
STKc_PKB_beta

?
cd05595: STKc_PKB_beta 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, Protein Kinase B beta (also called Akt2)
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in PKB-beta display normal growth weights but exhibit severe insulin resistance and diabetes, accompanied by lipoatrophy and B-cell failure. PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain.The PKB-beta subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 173686
View PSSM: cd05595
Aligned: 6 rows
Threshold Bit Score: 717.555
Threshold Setting Gi: 134104886
Created: 31-Aug-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 38 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:1O6K; Human PKB-beta binds AMP-PNP and GSK3 peptide substrate; defined at 4A contacts.
    View structure with Cn3D
  • Structure:2JDO; Human PKB-beta binds inhibitor and GSK3 peptide substrate; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1       ## ##   #            # #           #  #                #               ####   
1O6K_A     11 KLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGG 90  human
2JDO_A     16 KLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGG 95  human
1MRY_A     14 KLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGG 93  human
Q7ZX15    161 KLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTALKYAFQTSDRLCFVMEYANGG 240 African clawed frog
AAL16380  154 KLLGKGTFGKVILVREKATGMYYAMKILRKEVIIAKDEVAHTITESRVLQNTRHPFLTTLKYAFQTRDRLCFVMEYANGG 233 zebrafish
NP_997980 153 KLLGKGTFGKVILVREKASGMYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGG 232 zebrafish
Feature 1     # #   #                                # # ## #         ##  #             ######
1O6K_A     91 ELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKXFCGTPE 170 human
2JDO_A     96 ELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKXFCGTPE 175 human
1MRY_A     94 ELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPE 173 human
Q7ZX15    241 ELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFGLCKEGITDGATMRTFCGTPE 320 African clawed frog
AAL16380  234 ELFFHLSRERVFTEDRARFYGAEIVSALEYLHSKDVVYRDLKLENLMLDKDGHIKITDFGLCKEGITNEATMKTFCGTPE 313 zebrafish
NP_997980 233 ELFFHLSRERVFSEDRARFYGAEIVSALDYLHSQNVVYRDLKLENLMLDNDGHIKITDFGLCKEGITDEATMRTFCGTPE 312 zebrafish
Feature 1     ##                        #     #  #                                            
1O6K_A    171 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGG 250 human
2JDO_A    176 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGG 255 human
1MRY_A    174 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGG 253 human
Q7ZX15    321 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGG 400 African clawed frog
AAL16380  314 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRNLSPEAKALLAGLLKKDPKQRLGG 393 zebrafish
NP_997980 313 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYSQDHERLFEQIVMEEIRFPRSLSTHARALLTGLLRKEPKQRLGG 392 zebrafish
Feature 1                                                #   #                                
1O6K_A    251 GPSDAKEVMEHRFFLSINWQDVVQKKllPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDslgl---leldQRTHFPQ 327 human
2JDO_A    256 GPSDAKEVMEHRFFLSINWQDVVQKKllPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDslglleldqreEQEMFED 335 human
1MRY_A    254 GPSDAKEVMEHRFFLSINWQDVVQKKllPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDslgl---leldQRTHFPQ 330 human
Q7ZX15    401 GPNDAQEVMSHRFFVSINWQDVTERKltPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDnlda---lesdQRPHFPQ 477 African clawed frog
AAL16380  394 GPEDAKEVMTHKFFNNMNWQDVLQKKlvPPFKPQVTSETDTRYFDDEFTAQTITVTPPDQYDslda---edpdTRTHFSQ 470 zebrafish
NP_997980 393 GPDDARDVMMHKFFSGVQWDDVLQKKllPPFKPQVTSETDTRYFDDEFTAQSITVTPPDKLScqdv---eesgPIAHFPQ 469 zebrafish
Feature 1           
1O6K_A    328 FDYSAS 333 human
2JDO_A    336 FDYIAD 341 human
1MRY_A    331 FSYSAS 336 human
Q7ZX15    478 FSYSAS 483 African clawed frog
AAL16380  471 FSYSAS 476 zebrafish
NP_997980 470 FSYSAS 475 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap