Conserved Protein Domain Family
PTS_IIB_lactose

?
cd05565: PTS_IIB_lactose 
PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria. In this system, EII is a lactose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. The IIC and IIB domains are expressed as a single protein from the lac operon. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include lactose, chitobiose/lichenan, ascorbate, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.
Statistics
?
PSSM-Id: 99907
View PSSM: cd05565
Aligned: 8 rows
Threshold Bit Score: 155.639
Threshold Setting Gi: 139438375
Created: 2-May-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:most of the active site residues are contained within a P-loop which forms part of a binding pocket for the phosphoryl group
  • Comment:for the E coli chitobiose transporter IIB subunit,(not included in this IIB subgroup) in addition to the P-loop residues, two conserved residues are likely to be important in catalysis: a tyrosine whose side-chain points towards the phosphorylation site and a Gln residue whose side-chain lies close to the sulfur atom of the catalytic cysteine.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             # ## ##                                                                   
131496      467 TNVLVLCAGGGTSGLLANALNKAAAEYNVPVKAAAGGYGAHREMLPEFDLVILAPQVASNFDDMKAETDKLGIKLVKTEG 546 Lactococcus lact...
YP_814187   465 LNVLVLCAGGGTSGILAKSLNKLAKEDKLPLNAAAAAFGSHHDLISGMDVVILAPQMDTMKDELAKECKQNNARMITTTG 544 Lactobacillus ga...
ZP_01771891 489 KRVLVLCQGGGTSGLLANALAKAAKERGINLETAAEAYGNHVDMLPDFDLVVLAPQAASYLADLQKDCERVGNKCVACRG 568 Collinsella aero...
ZP_00604221 456 INVLVLCAGAGTSAMLANALKKGASESKAPISAMAGAYGSHYEMLQDFDMVVLAPQVNSYYDDIKEDTDRLGIKLVATKG 535 Enterococcus fae...
NP_358019   456 LKVLVLCAGSGTSAQLANAINEGAQLAEVRVIANSGAYGAHYDIMGVYDLIILAPQVRSYYREMKVDAERLGIQIVATRG 535 Streptococcus pn...
ZP_01771880 462 IRVLVLCQGAGTSTLLANALREGAAAKGIDLVSQSGAYGSHYETMDQYNVIVLAPQARMYYDAMKADTDRLGIKLLTTRG 541 Collinsella aero...
P24400      477 VDVLVLCAGGGTSGILANALNKLSKERGLKLSAAARAYGQDMDLIKDMNMVILAPQMESMKGNLKKITDKYGVKLVTTTG 556 Lactobacillus casei
NP_349566   458 QLVLVLCASGATSSMLANAITKGAKQEGVNVESIAMAYGQHKDVIADYDLIILAPQMASMYEELKADCASKGTKSATTTG 537 Clostridium acet...
Feature 1                          
131496      547 AQYIKLTRDGQGALAFVQQ 565 Lactococcus lactis subsp. lactis
YP_814187   545 KQYIYMTQHANECLKLLIN 563 Lactobacillus gasseri ATCC 33323
ZP_01771891 569 KQYIELSQNGDKSLAFVSE 587 Collinsella aerofaciens ATCC 25986
ZP_00604221 536 AEYIGLTRDPEKAVQFILN 554 Enterococcus faecium DO
NP_358019   536 MEYIHLTKNPSKSLQFVLE 554 Streptococcus pneumoniae R6
ZP_01771880 542 KEYIDLTNDPEGAIDWIVQ 560 Collinsella aerofaciens ATCC 25986
P24400      557 RQYIELTNNGDMALDFVES 575 Lactobacillus casei
NP_349566   538 KEYVKLTRDPVGALKFALD 556 Clostridium acetobutylicum ATCC 824

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap