Conserved Protein Domain Family
Peptidases_S53_like

?
cd05562: Peptidases_S53_like 
Peptidase domain in the S53 family
Members of the peptidase S53 (sedolisin) family include endopeptidases and exopeptidases. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of Asn in subtilisin. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Characterized sedolisins include Kumamolisin, an extracellular calcium-dependent thermostable endopeptidase from Bacillus. The enzyme is synthesized with a 188 amino acid N-terminal preprotein region which is cleaved after the extraction into the extracellular space with low pH. One kumamolysin paralog, kumamolisin-As, is believed to be a collagenase. TPP1 is a serine protease that functions as a tripeptidyl exopeptidase as well as an endopeptidase. Less is known about PSCP from Pseudomonas which is thought to be an aspartic proteinase.
Statistics
?
PSSM-Id: 173798
View PSSM: cd05562
Aligned: 25 rows
Threshold Bit Score: 158.61
Threshold Setting Gi: 84498360
Created: 1-Oct-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative activeputative
Feature 1:putative active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                   #     #   
NP_521222         163 ELTGKGITVGLISDSFncnsqlnqdaryvaqngrqdtmeddiarGELPGNGRIrivk---elrdCTDGTDEGRAMAEIIH 239  Ralstonia...
YP_001623276      190 SADGAGVYVGVISDSInrksvevadpdnpgatktvsgieaaqasGDLPATVNVlndgpantvaePNNSSDEGQAMAQIIY 269  Renibacte...
NP_616940         195 RVNGTGIKIGIISDGVdnled-------------------vqatGDLPSDVHVl---------sNNMGGNEGTNMLEIVY 246  Methanosa...
NP_619099         174 GVTGAGIKIGIISDGVedise-------------------ainsGILPEDIHIl----------SPGKGNEGTVMLEIVH 224  Methanosa...
ZP_00997157       182 GVDGSGIDVGVISDGVtsiaa-------------------aqalGDLPAGVNVl----------NAGSGDEGTSMLEIVH 232  Janibacte...
YP_502416          69 GADGSGIGIGIISNGAagliq-------------------aqesGDLPQNVIVl----------MNGRGSEGTAMMEIIH 119  Methanosp...
YP_502418          55 NADGAGVIVGVVSSGVkglad-------------------aqrsGDLPDSLVIl----------KEGKKAEGTAMMEIIH 105  Methanosp...
YP_502528         289 GLSGEGVKVGVISDGVdgled-------------------lkalGELPDVEVIs----------DTVGGDEGLAMLQIIH 339  Methanosp...
YP_503913          64 GASGKGIKVGVIGNGAeslel-------------------sqkmGELGPVTLY-----------ERGTGDEGTAMLEIIH 113  Methanosp...
REF_jgi:Noc_2169  164 GVTGKGVRVAVLDRGFqgyq--------------------dllgIELPLEVTTknfn----lgeGFEGTRHGTAVTEILY 219  Nitrosoco...
Feature 1                                                                     ###                     
NP_521222         240 DVAP-GADIVFYSggag-madFAQGIETLALPknksnaqgvaggGAQVIVDDLQYSYEPa-fQSGIVGAAIDNVVKn-hG 315  Ralstonia...
YP_001623276      270 DEAPgITQFAFASase---esKSVAINRLVNA------------GVKVIADDIYDITDPv-yQDDPSAVAAENAVSh--G 331  Renibacte...
NP_616940         247 DIAP-GAELYFHDcgks-rleFNRAIDVLVNE------------GCTVICDDIGWLAEPf-fEDGTVAAHVKEVIKd-hD 310  Methanosa...
NP_619099         225 ETSP-GAELYFHGagsn-kleFNKAVDALVAE------------GCQILCDDVGWPDEPf-fEDGVVAAHVKEVIEs-qG 288  Methanosa...
ZP_00997157       233 DMAP-GAGLLFHGtggg-vgaHVTAQNALAAA------------GVDIITEDIPFDSEPa-fQKGLAATNGETLAAs--G 295  Janibacte...
YP_502416         120 DIAP-GAPLLYHDfgggaqndFIYAIESLIDA------------GARIIVDDVGFLQVPy-fEDGYTAQNLNRILDehpE 185  Methanosp...
YP_502418         106 DIAP-GATLLYHDfgggreekFIEAFQNLINA------------GATIIVEDVFNYEVPy-fEDGTIAQEISKIIDenpD 171  Methanosp...
YP_502528         340 DIAP-NATLVFHDrgss-qieFVRALDQLIIH------------GCNIICDDITYVEPFf--EDGYISQNIIDRVLs-yN 402  Methanosp...
YP_503913         114 DIAP-DAELCFHAyggn-sddFKRAVSTLAAA------------GCRIICDDLYFFKQPf-lEDGDVADHIREVLKshpD 178  Methanosp...
REF_jgi:Noc_2169  220 DMAP-EAEFTLVAvst--eleYMAALDWLRAQ------------GVSIVSFSLGFDNLGpldGRSPISAAASRLFDe-aG 283  Nitrosoco...
Feature 1                  # ##                                                                       
NP_521222         316 IAYFTAGGNDGVgaspvsyinnnarfadqpidpngtgtpgrplnfdpsgasqvfslpvratrqivgfyrfslqlywdqpf 395  Ralstonia...
YP_001623276      332 ISYVTSAGNRGGnsafetqpafvadkskkeanpakpvnpaledfgngvtnkkiatiankgsvyydlqwkegwgtaksdlg 411  Renibacte...
NP_616940         311 LLYVSSAGNSGDshyqgffydngsgwhdfsrgkgevenlrleiqpsgkvwvflqwndrwedsgnnydlfikdgntle--- 387  Methanosa...
NP_619099         289 ILYVSAAGNDAGrhyqgmffdngsgwhdfssgvsgfrniymdvpagekvtvvlqwndpwngsendydlylydccsgn--- 365  Methanosa...
ZP_00997157       296 VWVSSSSGNLNSshaprvaanstgtfpdgaaaapagcpginansvafngadttfdvsvaagasigatlqwsepraifpta 375  Janibacte...
YP_502416         186 VILVSAAGNNAEihyqakfsddgsgyhsfdgmrgipiaiqpggmfsaflqwddmygnsandynlyleengelial----- 260  Methanosp...
YP_502418         172 LLIISSAGNTANnhyqavfsdggegyhsfngstgipleiqpggrvklhlqwddpytaasndfdlfihdlqsdsdva---- 247  Methanosp...
YP_502528         403 VLYITAAGNFAKehyqapfhgyedqgylwqdfqgstgrdmkftvpsglaghvilqwddrfgtsannydlflyddsgr--- 479  Methanosp...
YP_503913         179 CIYVTVSGNFASlhyqkswepglsigpeqtvhdfgdgysaipivlkpddeviitlqwddpwggavhdydlfltdpakge- 257  Methanosp...
REF_jgi:Noc_2169  284 ILFVAAAGNEQQnywsglfndldgngahdfsnedealsvqlregdevriilnwddwgedpahpraeqdydlyifcpgtvq 363  Nitrosoco...
Feature 1                                                                                             
NP_521222         396 dnstsslq-------------------------------vcladkngkpfnvmldgepypsctdasvigqqaiawgtllg 444  Ralstonia...
YP_001623276      412 lrl-----------------------------------------vnsagklltatslsddddvasgipqegvsyknttgr 450  Renibacte...
NP_616940         388 ---------------------------------------------------tiassevyqdgdnlpleyimytnsgnetl 416  Methanosa...
NP_619099         366 ---------------------------------------------------eiavsettqsgmdtplefikyvnkeedkk 394  Methanosa...
ZP_00997157       376 gaggftnldlyildaagancvasstgaqgggsgdtieqaswtnggaaaatvklvvnrtgatgakavptidlrwrgnanav 455  Janibacte...
YP_502416         261 ----------------------------------------------------seriqdgstlpeekftyindgkslvqae 288  Methanosp...
YP_502418         248 ---------------------------------------------------ignkvqtgeekpyekidyqnvgdkvqkae 276  Methanosp...
YP_502528         480 ---------------------------------------------------eiarsvniqdgdddpmewvrfvnsadrpr 508  Methanosp...
YP_503913         258 ------------------------------------------------vvatsmniqedtgepfehlvyrnemnesrris 289  Methanosp...
REF_jgi:Noc_2169  364 fs--------------------------------------------sdnacvssvglqtgllgqepieqvffaapatgry 399  Nitrosoco...
Feature 1                                                                                             
NP_521222         445 tepeatlqvflvdgtaprrvrlqtsrivigqfgtaDAALFGHVLSPNAIATGAANylatpmcdpslktaqlerfsshggg 524  Ralstonia...
YP_001623276      451 avdvyvqithkrgtpapsllrlrsnkdfvagfgnaITVNAGVSSAKGVIAAAASDwstptvpeecssr---------gpv 521  Renibacte...
NP_616940         417 nasievrktsgearelelyvyywtgttlrttnivsKDSIFGHPALPEVITVGAVGiggsgdyyie--------------y 482  Methanosa...
NP_619099         395 tlsiavkkycgedrilevyiypnssvkvhpdnlvaEDSVFGHPAVSGVICVGAVDtgnqesgsia--------------p 460  Methanosa...
ZP_00997157       456 dalgspgslnpdsnytdfatsagavnagssqdpttVGLETFSGQGPVTLLGTTVCstsypcpas---------------- 519  Janibacte...
YP_502416         289 lrikkenpsvedknielfinaqkdkvyitrqhlviEDSIIGQAAVPRVLSVAAISpekvnsier---------------- 352  Methanosp...
YP_502418         277 vrirakegkgqgshlellletdatrvvvgkeyltpNDSIIGWAALPNVISVAALSaenqkiqdf---------------- 340  Methanosp...
YP_502528         509 eftvkvvqaaaedalleiyvlplsgrsveldpytpEDSVFGQQAVKQALVVGAAApggknltvqe--------------- 573  Methanosp...
YP_503913         290 lsiirngenitpnilemyirnidprqvesevvkdpVDSIFGHAALEEVVTVGSVGigtpysvsp---------------- 353  Methanosp...
REF_jgi:Noc_2169  400 difivrgspgagarllrlfvggsqgeifpmeyqntASTLVSPSDGRSVFAVGAVDids---------------------- 457  Nitrosoco...
Feature 1                                                                             #               
NP_521222         525 lmlfdndgrALPRPVLDGKPDLVGPDGassvffgiqakdgdrgfgvynlnCRYYPAYPYQFYGTSAAAPHVAGVAALMRQ 604  Ralstonia...
YP_001623276      522 thyfdqngvALATPAVINKPDVMAPDG-----------------------VATTVDGFDAFSGTSAAAPATAGAAALALT 578  Renibacte...
NP_616940         483 fssigpvtlYYPSPEIRPKTDISGLDGv---------------------nVTGTGGVSEQFYGTSASCPHVAAIAALVWS 541  Methanosa...
NP_619099         461 yssrgpvsiYYPEPELRNKTDLSGPGRv---------------------kVSGSTGTGSFFTGTSASAPSVAGIGALIWS 519  Methanosa...
ZP_00997157       520 apagqnqsvAGAAGRTAIAPTYTAADGvsvsgag----------gfgagtCPAVAQGDCRFFGTSAATPSSAGVAALVLD 589  Janibacte...
YP_502416         353 yssqgfvtiSYPESTVRQKPDITGINNv---------------------aVSGAGGFPKKFPGTSAAAPHIAGLLALEWS 411  Methanosp...
YP_502418         341 -ssqgtvtiAYPVPDVREKPEITGVDGv---------------------sVTGAGDFPTPFTGTSAAAPHIAGLLALVKS 398  Methanosp...
YP_502528         574 yssrgpaliRYPVYELRKKPDLVAPDHi---------------------tVLTGSMQHAVFTGTSAAAPHIAGLAALVMS 632  Methanosp...
YP_503913         354 dssqgpvtiRIPEPSRRWKPDICAPTNv---------------------qVSGAGSFPVPFPGTSAAAPHVAGVIAQLLS 412  Methanosp...
REF_jgi:Noc_2169  458 ------qqlTFTSSLGPTWDGRVKPDIva--------------------pDGVTTAALGAFFGTSAATPYVAGAGALLKS 511  Nitrosoco...
Feature 1                                                             
NP_521222         605 AVPKAT---PEQIYSALRKTavdmd--apghDNATGAGFVQPERALRE 647  Ralstonia solanacearum GMI1000
YP_001623276      579 AYPAAT---PAQIKTWITSGnattpaaqgygANRVGSGLIQADLLVGL 623  Renibacterium salmoninarum ATCC 33209
NP_616940         542 SAPEKS---AMDIKRLLSTSstdlg--epgyDNVFGYGLVDALKLHEQ 584  Methanosarcina acetivorans C2A
NP_619099         520 MYPEKT---GNEIRGILCSSaedlg--epgyDTTFGYGSVNESIVFFL 562  Methanosarcina acetivorans C2A
ZP_00997157       590 ASGGPGsltASGLTSVLNANatdrg--pagaDNAWGSGVLDAYSAATN 635  Janibacter sp. HTCC2649
YP_502416         412 LFPSIP---ADDMRNALLSTalelg--epgwDPAFGYGLPDAIKMYEK 454  Methanospirillum hungatei JF-1
YP_502418         399 LYPTVP---NTELRDALLNSatdlg--tpgwDAIYGYGLADALSLHAY 441  Methanospirillum hungatei JF-1
YP_502528         633 GSLGMK---ESEVRKIILNAtgts---tdawDPVYGRGIPVATNLSLP 674  Methanospirillum hungatei JF-1
YP_503913         413 SFPDVS---RDDLLKALYSNafdlg--epgwDPTYGYGLIDAVKAFQF 455  Methanospirillum hungatei JF-1
REF_jgi:Noc_2169  512 QEPNRS---AQDLKLLLQQAstdra--aggkDNEYGSGALLLENFVAD 554  Nitrosococcus oceani ATCC 19707

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap