Conserved Protein Domain Family
POLBc_epsilon

?
cd05535: POLBc_epsilon 
DNA polymerase type-B epsilon subfamily catalytic domain. Three DNA-dependent DNA polymerases type B (alpha, delta, and epsilon) have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase (Pol) epsilon has been proposed to play a role in elongation of the leading strand during DNA replication. Pol epsilon might also have a role in DNA repair. The structure of pol epsilon is characteristic of this family with the exception that it contains a large c-terminal domain with an unclear function. Phylogenetic analyses indicate that Pol epsilon is the ortholog to the archaeal Pol B3 rather than to Pol alpha, delta, or zeta. This might be because pol epsilon is ancestral to both archaea and eukaryotes DNA polymerases type B.
Statistics
?
PSSM-Id: 99918
View PSSM: cd05535
Aligned: 22 rows
Threshold Bit Score: 956.742
Threshold Setting Gi: 19074730
Created: 23-May-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitemetal-binding
Feature 1:active site [active site]
Evidence:
  • Comment:Based on similarity to bacteriophage RB69 POLBc (1Q9Y)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                         
P21951        545 GHLLESETYVGGHVESLEAGVFRSDLKNEFKIDPSAIDELLQELPEALKFsvevenkssvdkvTNFEEIKNQITQKLLEL 624  baker's yeast
AAC77870      495 GKLLESETYIGGHVECLQSGVFRSDIPTSFKLDASAYQQLIDNLGRDLEYaitvegkmrmdsvSNFDEVKEVIREKLEKL 574  thale cress
XP_627031     549 NRPILNSTYVGGTVESLCSGVFRADIPEKFCLNTDTLKHLIKILDTTLNFgikdsg-ttidniENYEQVRNEILEKLQSL 627  Cryptosporidi...
XP_639211     527 GHLLESETYVGGHVECLESGVFRSDIPTNFSLDPASIEKHMGNIDQVLKFalkegg-ipldtvSNYQEVKEDVLKKFTLL 605  Dictyostelium...
Q5K9M7        573 GHLLASETYVGGHVEALEAGVFRSDIPTHFKIVPSAIQELIDDLDAALRFslieegqvkledvENYDEVKQQIQTALETM 652  Cryptococcus ...
CAL55806      551 GHLLNSETYIGGHVECLQAGVYRSDIPCDFNLTPDGYQKLLDTLDDDLKYalevegkmkqsdvSNYDEIRAAIVEKLEFL 630  Ostreococcus ...
CAM43651      491 GHLIDTETYIGGRVEALRSGVYRSDIPMTFDMNPDTYQSLMDDVDEALRFalevengvkveevTNLEEVRAAVLAKLTNL 570  Leishmania br...
XP_001431364  482 GHLIDSETYIGGKVECLRSGIYRSDIDVEFKIDKECMQSMWSTVDSLIRFvgkien--etfseEEIEKCSEQIRSKLDVL 559  Paramecium te...
NP_586236     468 GHIAESITYVGGHVECLKSGIFRSDFEYEFDVDKEFIDTVALKIDEMLSEyr---------geEGFEDMRGKVLRNLQEN 538  Encephalitozo...
XP_504422     515 GHLVDNETYTGGHVESLAAGVFRSDIMVDFDIDTNSIDELLVNLDETLEFcvtveagkkssdfENLDEVRDQIIEQLQEL 594  Yarrowia lipo...
Feature 1                         #  ###                                                          
P21951        625 KENn-iRNELPLIYHVDVASMYPNIMTTNRLQPDSIKAERDCASCDFNRPGK--TCARKLKWAWRGEFFPSKMDEYnmik 701  baker's yeast
AAC77870      575 RDDp-iREEGPLIYHLDVAAMYPNIILTNRLQPPSIVTDEVCTACDFNGPEK--TCLRKLEWVWRGVTFKGNKSEYyhlk 651  thale cress
XP_627031     628 LESp-rIKIEPLIYHLDVAAMYPNIILTNRLQPTAVIEETTCMKCPFNSESK--LCQRRMNWRWKGDVFPISKGEMermi 704  Cryptosporidi...
XP_639211     606 KENp-kQQSHPLIYHLDVSAMYPNIILTNKLQPTAVVNDEVCATCVYNKPES--QCQRTLDWQWRGDYSPSNQSEYrlil 682  Dictyostelium...
Q5K9M7        653 RDEp-nRFDNPLIYHLDVAAMYPNIMLSNRLQPDSVKEEADCAVCDYNRPDK--KCDRRMEWAWRGEYFPAKRDEVnmvr 729  Cryptococcus ...
CAL55806      631 RDNp-rIKSKPLIYHLDVAAMYPNIILTNRLQPAAMVTEDVCAACDYNRPGK--KCLRELEWVWRGEHFASTSSEYaqik 707  Ostreococcus ...
CAM43651      571 RNRp-hQQEKPFIYHLDVGAMYPNIILTNRLQPYAIARPDVCAGCCFNSPNNeaQCKRVMSWKWRAELFTAGRYEFqrvk 649  Leishmania br...
XP_001431364  560 INRgevFKEKPLIYHLDVAAMYPNIILTNRLQPVSIVGDQICSQCYFNQPQN--RCQRQLEWQWKGDFFPLKRTEYefvk 637  Paramecium te...
NP_586236     539 RGG---FRREGLIYHLDVGAMYPNIILTNKLQPIAIVDEDACIRCDFSDESN--GCKKRMEWTLKVEYIPAGREETerir 613  Encephalitozo...
XP_504422     595 KSNp-kRSDYPLIYHVDVASMYPNIMTTNRLQPDSMVDEKDCAVCDYNRPDK--TCARELEWARRVDYYPVSKGDVnnlk 671  Yarrowia lipo...
Feature 1                                                                                         
P21951        702 ralqnetfpnkn-------------------------------------------------------------------- 713  baker's yeast
AAC77870      652 kqiesesvdag--------------------------------------------------------------------- 662  thale cress
XP_627031     705 nhiqietfenvkneigavnkkkkfedhe---------------------------------------------------- 732  Cryptosporidi...
XP_639211     683 qqlesekfgd---------------------------------------------------------------------- 692  Dictyostelium...
Q5K9M7        730 yaleqetfppk--------------------------------------------------------------------- 740  Cryptococcus ...
CAL55806      708 aqlqvdtfpaa--------------------------------------------------------------------- 718  Ostreococcus ...
CAM43651      650 aqlenesfaagvieqanlaavqkkaygnrkgnvlegtlyerkddwrknqrnrnsssssggggyrqesrrqqreaadallq 729  Leishmania br...
XP_001431364  638 qqleqeqtekerkeneekkk------------------------------------------------------------ 657  Paramecium te...
NP_586236     614 kqir---------------------------------------------------------------------------- 617  Encephalitozo...
XP_504422     672 qglveeysggrfgngssvei------------------------------------------------------------ 691  Yarrowia lipo...
Feature 1                                                                                         
P21951        714 ----------------kfskkkvltfdelsyaDQVIHIKKRLTEYSRKVYHRVKVSEIv-EREAIVCQRENPFYVDTVKS 776  baker's yeast
AAC77870      663 -----------------anmqsskpfldlpkvEQQSKLKERLKKYCQKAYSRVLDKPIteVREAGICMRENPFYVDTVRS 725  thale cress
XP_627031     733 sdsenddkmeftgenvninnkekikwssltprQQSEILIQRMKAYCNKIYRKQTENIEe-TRSSIVCQRENPFYIDTVRR 811  Cryptosporidi...
XP_639211     693 -------------------gderksflslseeKRNELLRKRLKEYSRKVYRKTHQITQe-IRSDTICMRENSFYVDTVRL 752  Dictyostelium...
Q5K9M7        741 -----------------rpydpkrrfvdltptEQSALLHKRLGDYSRKVYKKTHDTKIv-TKTTIICQRENSFYIDTVRA 802  Cryptococcus ...
CAL55806      719 -----------------dpggssrtwyelsyeEQQEQKKNRLKMYTQKVYRKVMEKPVtaTKTAGICQRENAFYIDTVRA 781  Ostreococcus ...
CAM43651      730 refgadrngvsgdsdsdddvdgpkayhkltenTQFNMLKRRLSEYSRKAYGKIHETREv-MQSNVVCQRENSFYVDTVRL 808  Leishmania br...
XP_001431364  658 ---------qmlkegldtrrlqlkgfsdlapdEQIKRIKQRVIEHCKKTYKTIHHHSVe-LKKDTVCMRENDFYVQTVRD 727  Paramecium te...
NP_586236     618 -------------------------rekgfagDENEELRQRARRYSKDTYRRAKVRESc-IRSSTVCQREIPFYVETVRK 671  Encephalitozo...
XP_504422     692 --------sydegmterekfqkrkgwaglsgqEQANKLKERVAAFSLKTKARKTDSETt-VQKTIVCQRENPFYVDVVQE 762  Yarrowia lipo...
Feature 1          #                                                 #   #                        
P21951        777 FRDRRYEFKGLAKTWKGNLSKIDPSDKHARDea----kKMIVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGITCL 852  baker's yeast
AAC77870      726 FRDRRYEYKTLNKVWKGKLSEAKASGNLIKIqe---ahDMVVVYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVTY 802  thale cress
XP_627031     812 FRDRRYVYKGKKKEAEEKLKRAELLGDLLAVqe---aqNEELLYESLQLAHKCILNSFYGYVMRKGSRWFSMEMAAIVTW 888  Cryptosporidi...
XP_639211     753 FRDRRYVFKNHHRDWKIKYDQAMQESGGTNSvavvaaqGMVVLYESLQLAHKCILNSFYGYVMRKGARWYSMQMAGIVTH 832  Dictyostelium...
Q5K9M7        803 FRDRRYEYKGLHKTWKKNLDKAFEEGGAVATvde--akKMIVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGITCL 880  Cryptococcus ...
CAL55806      782 FRDRRYVYKGKNKEAGKQLEAAKQAGSIADIqq---aaNNVVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVTN 858  Ostreococcus ...
CAM43651      809 FRDRRYEYKAALKIWKKKLDAAKDADERKLCq------SRCVQMESLQLAHKCILNSFYGYVMRKGSRWSSMEMAGIVTY 882  Leishmania br...
XP_001431364  728 FRDRRYEFKELVKVYKNKLEQAKKEGVGVKEc-----hDFMALYESLQLAHKIILNSFYGYVMRKGARWYSMPMAGIVTH 802  Paramecium te...
NP_586236     672 FRDQRYVYKKLHSQAQKAFESASSDEERKHAm------KSVVVYSSLQIAHKCVLNSFYGYVMRKSSRWYSMEMAAIVCN 745  Encephalitozo...
XP_504422     763 FKQRRIDYKTKAKRWNKEAASASDPASREEAk------KMAITNDSMQLAHKVILNSFYGYVMRKGSRWYSMEMAGVTCY 836  Yarrowia lipo...
Feature 1                                 #                                                       
P21951        853 TGATIIQMARALVERVGRPLELDTDGIWCILPKSFPETYFFtlen--gkkLYLSYPCSMLNYRVHQKFTNHQYqelKDPL 930  baker's yeast
AAC77870      803 TGAKIIQNARLLIERIGKPLELDTDGIWCALPGSFPENFTFktid--mkkFTISYPCVILNVDVAKNNSNDQYqtlVDPV 880  thale cress
XP_627031     889 VGGNVIREARSLMEGIGRPLELDTDGIWAILPKGFPEEITFrlkd--ggkKKIHYICTLLNQQVHKSWTNDQYl-eYDAD 965  Cryptosporidi...
XP_639211     833 TGSNIIKEAREVVEQMGRPLEIDTDGIWCILPSHFPENYTLksas-tgkkVTFSYICEMLNEKVAKSFTNHQYq-dYNAE 910  Dictyostelium...
Q5K9M7        881 TGATIIQMARQLVEQIGRPLELDTDGIWCMLPGVFPEDFNFklkn--gkkFGISYPCTMLNHLVHAQFTNDQYhelVNND 958  Cryptococcus ...
CAL55806      859 TGAKIIQMAKQLVDDIGMPLELDTDGIWCCLPCEFPEDYTFtmkgegkkpYQISYPCVVLNRMTAVRNTNDQYl-tFDEK 937  Ostreococcus ...
CAM43651      883 LGATLIQMARSLVQQIGVTLELDTDGIWCCLPNTFPENFTFtttnaskpqISISYPCVVLNKMVHDRYTNHQYq--NLLS 960  Leishmania br...
XP_001431364  803 MGSQIISTAKQRVDQIGLPLELDTDGIWCLLPSGFPEDFLIksqt--grnLKFSYPCYILNELVYEKYKNNQYqwlKDPN 880  Paramecium te...
NP_586236     746 VGGNIIKRAKEVVEKIGISLELDTDGIWCIVPSSLISSYTLps------gRRFSFLSSLLNHFVCKEFTNWQY---QERV 816  Encephalitozo...
XP_504422     837 TGAKIIKIARQTMEGLGIPLELDTDGIWCMLPKTFPEKFKCkfkd--gssYELEYPCSIMNYLVHRDFTNHQYq-kLNPE 913  Yarrowia lipo...
Feature 1                                                                                         
P21951        931 NYIYETHSENTIFFEVDGPYKAMILPSSKEEGKGIKKRYAVFNEdGSLAELKGFELKRRgeLQLIKNFQSDIFKVFLEGD 1010 baker's yeast
AAC77870      881 RKTYNSRSECSIEFEVDGPYKAMIIPASKEEGILIKKRYAVFNHdGTIAELKGFEMKRRgeLKLIKVFQAELFDKFLHGS 960  thale cress
XP_627031     966 LGKYNIKVENSIYFEVDGPYKCFFIPASDKQNKLLKKRYAVFDFeNRLKELKGFELKRRgeLQLIKILQEELFPAFLKGN 1045 Cryptosporidi...
XP_639211     911 TNTYTIRDECSILFECDGPYRCMLIPTSKEKDVKLKKRYAVFNReGRICELKGFEIKRRgeLKLIKLFQSEVFKEFLGGD 990  Dictyostelium...
Q5K9M7        959 SGTYNVKKENSIFFELDGPYKAMILPSSKEEDKLLKKRYAVFNPdGSLAELKGFEVKRRgeLQMIKIFQSQIFDKFLLGK 1038 Cryptococcus ...
CAL55806      938 TGTYKQSSEMSIEFEVDGPYKAMILPASKEEGVLIKKRYAVFDEaGKLVELKGFELKRRgeLKLIKVFQSEVFDYFLKGE 1017 Ostreococcus ...
CAM43651      961 TGVYRTHSECSIYFEVDGPYLAMLLPASREEGKSIKKRYAVFNPdGQLGRAQRVELKRRgeLMLVKDFQSQVFRRFLDGS 1040 Leishmania br...
XP_001431364  881 SFEYGIRSEMSIFFEVDGPYRCMIIPAAREENKQLKKRYVVYNKnGSIAEVKGFEIKRRgeLQIIKQFQQELFSEFLKGT 960  Paramecium te...
NP_586236     817 DGKYVMRAENSIFFEIDGPYRAMLLPSSTEESKLLKKRYAIIDSnNRIAELKGFEIKRRgeLEIVKKFQEELFLHFLDGS 896  Encephalitozo...
XP_504422     914 TGKYDTHSENSIFFELDGPYKCMMMPTSTDKGKGLKKRYVVFDDrNKIVELKGFEVKRRgeLSLIKKFQSQLWDTFLEGS 993  Yarrowia lipo...
Feature 1                                                                                         
P21951       1011 TLEGCYSAVASVCNRWLDVLDSHGLMl-EDEDLVSLICENRSMSKTLKEYE-GQKSTSITTARRLGDFL-GEDMVKDkgL 1087 baker's yeast
AAC77870      961 TLEECYSAVAAVANRWLDLLEGQGKDi-ADSELLDYISESSTMSKSLADYG-QQKSCAVTTAKRLADFL-GDTMVKDkgL 1037 thale cress
XP_627031    1046 SKKEAYDHVAAISKKWLSLIDTKGRGilDDEQLFFLISESKNMSKSVQQMG-NAKSMSITTAKRLFEFLqNPSYIQDknI 1124 Cryptosporidi...
XP_639211     991 SLEGCYQSVGAVANRWLDILDSHAENy-EEKDLIELITESSNMSRKLEEYG-TQKSSAISTAKKLAEFL-GDDMIKDkgL 1067 Dictyostelium...
Q5K9M7       1039 TTEECYAAVATVADQWLDILQSKASSl-HDDELVDLIAENRSMSKTLAEYA-GQKSTSISTARRLAEFL-GEQMVKDkgL 1115 Cryptococcus ...
CAL55806     1018 TLDGVYQAVGAIANRWFDMLKTRGAKf-DDEELMEYISESSVMSKPAIDYG-DRKSTSLTTARRLAQFL-GADLVKDkgL 1094 Ostreococcus ...
CAM43651     1041 TLADAYASAAVVANAALDMLESKGEGy-DTEEILEKITESSNMTRRLSEYPeSQKSLAITTARRIAEFL-GPQMVKDkgL 1118 Leishmania br...
XP_001431364  961 NLTECYQACAEVGKKLLRILMTGGEGi-SQQELLDLIGESRVLSKEISEYD-NKKGVAITAGKRIAEYL-GSDQVRGgsL 1037 Paramecium te...
NP_586236     897 NLEECYESLAGVCRYWLDILKSRGEYl-DDDTILELLSESRSMSKGFGEYR-GRKSNLTVTALRMSELL-GEGILEEk-L 972  Encephalitozo...
XP_504422     994 NLVECYAAQARVAEAWLAVIDSRGKNl-SDEELIDLVCENKSMSKPVHEYG-SQKSTALTTARRLAEIM-GDSILTGgkL 1070 Yarrowia lipo...
Feature 1                                                                                         
P21951       1088 QCKYIISSKPf--------------NAPVTERAIPVAIFSADIpik-rsfLRRWtldp---------------------- 1130 baker's yeast
AAC77870     1038 RCQYIVAREPe--------------GTPVSERAVPVAIFQTDDpek-kfyLQKWcki----------------------- 1079 thale cress
XP_627031    1125 VCKFIVSEFPk--------------GEDKSQRAVPLSIFSTPLetr-vswLSKWlrisksggrrekdelvehrrkadvdi 1189 Cryptosporidi...
XP_639211    1068 SCQYIISNKPa--------------GSPITERALPVAIFDADFetr-chyLRRWtksp---------------------- 1110 Dictyostelium...
Q5K9M7       1116 SCRFIISAKPn--------------GAPVTERAVPVAIFTAEEpvk-rhyLRKWlkdn---------------------- 1158 Cryptococcus ...
CAL55806     1095 VCKYIISKKPl--------------GAPTSQRAIPVSIFNAEVsva-rsfLKEWtkdndls------------------- 1140 Ostreococcus ...
CAM43651     1119 ACHFIISRMPa--------------GRPVTERAIPVTIFRADQair-thfLRKWtadtt--------------------- 1162 Leishmania br...
XP_001431364 1038 NCQYIITKLPh--------------NTPVNERSIPLLIFESSFetr-kkyLRKWlkepq--------------------- 1081 Paramecium te...
NP_586236     973 KCEYIVAVYPe--------------NGSVAERAIPVVVFRSEQke---efLRRWmgr----------------------- 1012 Encephalitozo...
XP_504422    1071 STKYIIAVRTknsmpvpeakkgsdeDSSTADRAIPTLVFETESldeklrfLKRWmgpr---------------------- 1128 Yarrowia lipo...
Feature 1                                                            
P21951       1131 ---------------sledLDIRTIIDWGYYRERLGSAIQKIITIPAALQG 1166 baker's yeast
AAC77870     1080 ----------------ssyTGIRSIIDWMYYKQRLHSAIQKVITIPAAMQK 1114 thale cress
XP_627031    1190 tsgsgggsgilnkenennkWNVRNILDWEYYKNRLTNTILKIVIIPAINQG 1240 Cryptosporidium parvum Iowa II
XP_639211    1111 ----------------sgdLDIRELIDWDYYRQRLSGVIQKIITIPAALQN 1145 Dictyostelium discoideum AX4
Q5K9M7       1159 ---------------sltdFDLRTILDWDYYTERLGSVIQKLITIPAALQK 1194 Cryptococcus neoformans var. neoformans B-...
CAL55806     1141 -------------geddemPDMRDLVDWEYYKTRLAGAIQKIISIPAALQG 1178 Ostreococcus tauri
CAM43651     1163 ---------------vpseLNLKALLDWDYYIARFSACVQKIVSIPAALQS 1198 Leishmania braziliensis
XP_001431364 1082 --------------lqdedLTLSKIVDWDYYIERLKNTILKLLVIPAALQN 1118 Paramecium tetraurelia
NP_586236    1013 ----------------dylGDIRAIIDWDYYRQRLECVVQRMVILPALSQG 1047 Encephalitozoon cuniculi GB-M1
XP_504422    1129 ----------------wesTDPRDVIDWMYYRERLATTINKLVVIPAILLG 1163 Yarrowia lipolytica CLIB122

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap