Conserved Protein Domain Family
POLBc_zeta

?
cd05534: POLBc_zeta 
DNA polymerase type-B zeta subfamily catalytic domain. DNA polymerase (Pol) zeta is a member of the eukaryotic B-family of DNA polymerases and distantly related to DNA Pol delta. Pol zeta plays a major role in translesion replication and the production of either spontaneous or induced mutations. Apart from its role in translesion replication, Pol zeta also appears to be involved in somatic hypermutability in B lymphocytes, an important element for the production of high affinity antibodies in response to an antigen.
Statistics
?
PSSM-Id: 99917
View PSSM: cd05534
Aligned: 28 rows
Threshold Bit Score: 624.624
Threshold Setting Gi: 156089459
Created: 25-May-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitemetal-binding
Feature 1:active site [active site]
Evidence:
  • Comment:Based on similarity to bacteriophage RB69 POLBc (1Q9Y)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                  #  ###                 
O60673       2558 GSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMRAPQCVPLIMEPE-SRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGH 2636 human
XP_001424691  959 GSQFKIESILNRVTKLNDYLLLSATRVQVSTQKILECMPLVVEPP-KIFTVDPLIVLDFQSLYPSIMIAYNLCFSTCLGS 1037 Paramecium te...
XP_001011832 1163 GHQFRIEHIMNRVTDLLGYKLMSASRYGVQTQRMLECSPLTLEPP-KLFYVDPVIVLDFISLYPSIMIAYNLCFSTCLGY 1241 Tetrahymena t...
XP_001017761 1328 GSQFRVEGVLVRVTKQYGYLMLSASRMQVASQKILECMPLVMEPP-KMLFVDPVIVMDFQSLYPSVMIAYNYCYSTCLGN 1406 Tetrahymena t...
XP_001732319  883 GSQFRVESVLLRITKPRSYVLPSPNRAQVAQQNAPECLPLVLEPC-SGMYRGPVVVLDFQSLYPTMMMAYNLCYSTCVGR 961  Malassezia gl...
XP_656768     812 RGSQYKVECYLKRVSKSEFKLFSPSDNQLNSSRATDCVALVMEPQ-SGFHSNPVIVLDFLSMYPTTAIAYNICYSTCLGY 890  Entamoeba his...
CAM36652     2129 GSQFRVEATFLRLAQPLGYAMLSPSLSQVHRQPRIECIPLVMQPKsDLYRHDPVVVLDFRSLYPSVIIAYNLCYSTCLGM 2208 Leishmania br...
XP_847160    1240 GSQYRVEATLHRMAKPMGFALLSPPLEVVHRQPRLQSMPLIMQPRsGFYKDDPVVVLDFRSLYPSIVIAYNICYTTCLGS 1319 Trypanosoma b...
XP_001612136  850 GSQYHVESVLLRFTKSYGYLLPSPTQRQVHEQRPSVAIPIVMQPQ-SGLHLAPVAILDFQSLYSCITIAYNICYSTCLGL 928  Babesia bovis
CAB90776      899 GSQFKVESIMFRIAKPENYIFPSPSAKQVAEQNALEALPLVMEPK-SDLYNNPVVVLDFQSLYPSIIIAYNLCYSTCLGP 977  fission yeast
Feature 1                                                                                         
O60673       2637 VENLGkydefkfgctsl---------------------rvppdllyqvrHDITVSPNGVAFVKPSVRKGVLPRMLEEILK 2695 human
XP_001424691 1038 IKEEFqeggkkrfgvvatdid-------------fesllqkyqnqeelmKHILITPNNVAFLTKDVRVGIIPQILNEFLM 1104 Paramecium te...
XP_001011832 1242 IDDNFqkggfkklgvqkqwdvq-----------feellkkhnydidelmKDIFVAPNKVAFVKKSVREGVLSQITHEFFF 1310 Tetrahymena t...
XP_001017761 1407 INEQFnnggsgrlgvnqdahlkfe-------qlfgkdrkfnpkdmdqyhQDIFIAPNKVAYVRKTIREGILPQILHEFLL 1479 Tetrahymena t...
XP_001732319  962 VTPFKgsyklgftqhaelpprtaaa----pvaspatawqqqsqeqqqqdTNVYILPNGLAFVRPHIREGILPRMLHEVLS 1037 Malassezia gl...
XP_656768     891 VDDINierkigpmtys-----------------------fekenlhtlkGNIHVVANGIMFVDACVRKGILPIMLEEMLS 947  Entamoeba his...
CAM36652     2209 VQPQShgrlgvlprfkqsd----------------atlaellsddgaqhDGVVFTLNGAMFVPPSTRVGLLPQMMKAVLD 2272 Leishmania br...
XP_847160    1320 VGKGVygrlgvlksykrddmllssllsgladtkndhngknddnensntlHGVTFTPNGCMFLTPENREGVLPQMLRVLLD 1399 Trypanosoma b...
XP_001612136  929 LSEHKknsgsiklgimtyype-------------egileditehrtdkgIGVHITPNGVMFVDKRVREGILPMMLKVVLQ 995  Babesia bovis
CAB90776      978 VKIVNgkvklgfmfhs-----------------------snpnivnlikNDVYISPNGYAYVKENVRKSLLAKMLEELIE 1034 fission yeast
Feature 1          #                              #   #                                           
O60673       2696 TRFMVKQSMKAYKqd---rALSRMLDARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNdtkK 2772 human
XP_001424691 1105 TRIMIKKSTSLYDkh---pKIQKQHGFRQLAIKLFMNVMYGYCGASFSGRMPSGDIADSVVELGRTILNQCIECINtnpA 1181 Paramecium te...
XP_001011832 1311 TRQFIKGNMGKYKqnplynHIYNKLQQRQKSLKLFMCVIFGYTGATFSGRMPLGDLADSIIQIGKFLLNQAINLINnskK 1390 Tetrahymena t...
XP_001017761 1480 TRIMIKKSAGFYKdd---kYLSKLLDAQQQSIKLFMCVVYGYTGASFSGRMPSVDIADSIVETGRYLLNQVCEYINsnkD 1556 Tetrahymena t...
XP_001732319 1038 ARIMTKHTLKRLPkea-ghVPQRRLQAQQLALKLLANVTYGYCGATASGRMPCVEIADAIVQSARETLEKAMALIEqtpE 1116 Malassezia gl...
XP_656768     948 TRQHIKERMKMFTkg---sEAYKKCFLQQLALKLLCNVVYGYTGAGLSGRMPCNEIADAIVETARQTLEKAINFAEr--K 1022 Entamoeba his...
CAM36652     2273 ARFEVQAALKHIAapledmAMEQRLQEQQLALKMLANVTYGYTAASYTGRMPCVDLAEAIVSLGRQTLERAIALIHstpA 2352 Leishmania br...
XP_847160    1400 TRVDLQAALKHVAhpfgdiYMQQILQEQQMAIKMLANTTYGYTAASFTGRMPCADVADAIVMLGRQTLERAMWLINshpV 1479 Trypanosoma b...
XP_001612136  996 SRRKIKEAMKQPDmd---aISLHKLDREQHGLKMLSNLSVGLTASSYSGRMPCSDLAESVVSIARALILHCREIVHn--N 1070 Babesia bovis
CAB90776     1035 TRNMVKRGMKDCDs----dYVNKVLNSRQLALKLIANVTYGYTSASFSGRMPCSEIADTIVETGREILSYSLEYINtldF 1110 fission yeast
Feature 1                   #                                                                     
O60673       2773 WGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETldqKDPVFDA 2852 human
XP_001424691 1182 WQAKVLYGDTDSLFVMLPGRTVNEALLIGNQIAQHCTSLYPHPIELKFEKVYSEALLVAKKRYVGNKFEK---GEFQLDG 1258 Paramecium te...
XP_001011832 1391 WGAQVIYGDTDSVFVNIKGVSVNDAIKIGKEIESEVSKMFPYPLKLKYEKTYQNLVILTKKRYAGFFVENe-tDEPKFEA 1469 Tetrahymena t...
XP_001017761 1557 WYAKVVYGDTDSVFVLLKGRSVEEAFRIGKEIAESITKQYPYPIELKFEKVFRELILVSKKRYVGYKMEKi-tDKPEFLA 1635 Tetrahymena t...
XP_001732319 1117 WGADIVYGDTDSIFVHLPGQSKDDAFRIGHEIAERITAMNPAPVRLNFEKVYLPCMLVAKKRYAGYRFDTkeqARATLDV 1196 Malassezia gl...
XP_656768    1023 FGGKVIYSDTDSLFVEMEGKTIEESFEVGKQLCEEFNKTIPPPMKLQLEKVYWPLVTVTKKRYFGMKYEKc-eTKPTLEA 1101 Entamoeba his...
CAM36652     2353 WRAEVVYGDTDSLFVRLSGRTKTDAFRIGQEIADAVTQSNPTPIRLQLEKVLLPCLLLVKKRYAGYMWSSptqAAPTFLA 2432 Leishmania br...
XP_847160    1480 WKAEVVYGDTDSLFVRLPGRTKEEAFAVGEEMAKEVTAVNPAPVRLQFEKVLFPCLLLVKKRYVGYAYFKpeqQEPQFLA 1559 Trypanosoma b...
XP_001612136 1071 FDAEVIYGDTDSIFIKFPGKNVVEAEAEAKKIAKKINEAVPEPIKILFQKVYSPCILVSKKRYLGLAHID---GQVFYDD 1147 Babesia bovis
CAB90776     1111 CHAKVVYGDTDSLFVELPGATKEQAFDIGQQLANNITSRFPSPIRLKFEKIYFPCFLLAKKRYVGFKFESvsqKAPIFEA 1190 fission yeast
Feature 1                                                                                         
O60673       2853 KGIETVRRDSCPAVSKILERSLKLLFeTRDISLIKQYVQRQCMKLLEgkASIQDFIFAKEYRgsfs----ykpgACVPAL 2928 human
XP_001424691 1259 KGLEIIRRDGFPALQKIQKKAINILFkTKDLSQLKLYMQKQWAKILQdhVDIQDYIMAKEVKlgs------ykeGRLPAH 1332 Paramecium te...
XP_001011832 1470 KGLEVMRKDGCQALSIIMKNCLETLLkNKNLSAIKLYLNGEWQKLLNdqFSYRDLIISKECKle--------nyTMPPPH 1541 Tetrahymena t...
XP_001017761 1636 KGIEIVRRDGCDAVVKLMKKSLNILFeTKNLSKLKNYLNKQWAKILHghVNFKDFCIAKEVKlgk------ykeDRVPAH 1709 Tetrahymena t...
XP_001732319 1197 KGLEMIRRDGHVALQRMQETCLRILFeTHDMTAMKRYCQRQWAKLYTndVLPLYLLMSKEVRmgty-----asgASMPPG 1271 Malassezia gl...
XP_656768    1102 KGLEAVRKDSCEVVRGMMASVMKYLL-NKDIEGMKQYLEINWEMIQKgeGFIDDFVISRPYRrhy------aegRKPPIG 1174 Entamoeba his...
CAM36652     2433 KGIETVRRDQCPATALLVERLLRLLFdGASATALRRSYYAAVERLQSgaANPIQCIFRRGVRlgryr---dsgdAHLPLA 2509 Leishmania br...
XP_847160    1560 KGIETVRRDQCPATAHLAAKMIHLLFsGAGTETLRQCFYEEVSKLQRgdCSPVDCIFRKAVKfgry-----kpnGRLPAA 1634 Trypanosoma b...
XP_001612136 1148 KGVETMRSSECNLTRALLKDVLESILkTKSLDTAYEQLVRAFRDLSHm-WTLKDFITYRQVRlgtyseevtgqvGTLPAA 1226 Babesia bovis
CAB90776     1191 KGIETVRRDGTPVQQQLLRRCLEILFkTKDLSTVKKEFQNVCYQIMSgnVPVMDFCFSKEVRleky-----kelSTAPPG 1265 fission yeast
Feature 1                                                                                         
O60673       2929 ELT--RKMLTydrRSEPQVGERVPYVI------------------------------IYGTPGVPLIQlvrrpv---evl 2973 human
XP_001424691 1333 AVVatKIMNSd-pMRRPKGGERVPYVV------------------------------IQAQGTSKLADlvvni------y 1375 Paramecium te...
XP_001011832 1542 ARIalKEMKRd-pQTKPKYGQRIKYFI------------------------------INNPQSQRLYDcvvsvn---efm 1587 Tetrahymena t...
XP_001017761 1710 GIVglKITEQd-qLAKPKYGERVKYLV------------------------------VQGEQKSKVKDlvvsvp---eff 1755 Tetrahymena t...
XP_001732319 1272 AAVamQRMRHd-pAYMPHAAERVPYLI------------------------------QHGAPSAKLQDlalsph---ell 1317 Malassezia gl...
XP_656768    1175 TKVvlKERERd-nTFYFQYGQRVKYVV------------------------------VRTSSGKLCDSavspq-----fa 1218 Entamoeba his...
CAM36652     2510 ARValEQMEKd-vTQTPYWGERLPYVV------------------------------VRSTTAKKLADkvlhper--llq 2556 Leishmania br...
XP_847160    1635 ARLaaLLVEKd-aMRTPYWGERIPFVV------------------------------IRRPESTRLSDrvvhpqq--lls 1681 Trypanosoma b...
XP_001612136 1227 AIVakYKIEKh-yGDRILENEYIPHVFthsriehysgvkggavypndvigifkphdyIKERGYKTLPQntvqsimdqikq 1305 Babesia bovis
CAB90776     1266 AVMarRLMTKd-pRREPQYGERVPYLI------------------------------IAAAPGTTLANrsvape---efl 1311 fission yeast
Feature 1                                          
O60673       2974 qdpTLRLNATYYITKQILPPLARIFSLIGIDVF 3006 human
XP_001424691 1376 dfqSTMKLNPHYYIKQINAAVGRLFACFDIDIA 1408 Paramecium tetraurelia
XP_001011832 1588 knyRHQINLNEYLEKQINSALGRLFSTFDVDIQ 1620 Tetrahymena thermophila SB210
XP_001017761 1756 nkfNHQMNSLYYINRQINSSIGRLFSTFDVDIK 1788 Tetrahymena thermophila SB210
XP_001732319 1318 rvwPLALHMEYYVRRTILPALDRLLGLVGVNVY 1350 Malassezia globosa CBS 7966
XP_656768    1219 aseQMIIDSDYYINKQINNALQRILLPCGIDIN 1251 Entamoeba histolytica HM-1:IMSS
CAM36652     2557 iddTHSLDATYYIVRHINSALDRLFYLVGISFA 2589 Leishmania braziliensis
XP_847160    1682 dedHLMLDSEYYITRHIVPTLDRMFYLVGVSCG 1714 Trypanosoma brucei TREU927
XP_001612136 1306 ampLHLVDVDYYLKRQLFPPLQRMLQVLDTSPQ 1338 Babesia bovis
CAB90776     1312 sssFSQLDINYYINNSLIPPLDRFLNLLGASAQ 1344 fission yeast

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap