Conserved Protein Domain Family
POLBc_delta

?
cd05533: POLBc_delta 
DNA polymerase type-B delta subfamily catalytic domain. Three DNA-dependent DNA polymerases type B (alpha, delta, and epsilon) have been identified as essential for nuclear DNA replication in eukaryotes. Presently, no direct data is available regarding the strand specificity of DNA polymerase during DNA replication in vivo. However, mutation analysis supports the hypothesis that DNA polymerase delta is the enzyme responsible for both elongation and maturation of Okazaki fragments on the lagging strand.
Statistics
?
PSSM-Id: 99916
View PSSM: cd05533
Aligned: 25 rows
Threshold Bit Score: 678.988
Threshold Setting Gi: 71033557
Created: 23-May-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitemetal-binding
Feature 1:active site [active site]
Evidence:
  • Comment:Based on similarity to bacteriophage RB69 POLBc (1Q9Y)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                #  ###                                                   
P90829        551 EGYEGATVIDPIRGFYNEPIATLDFASLYPSIMIAHNLCYTTLLKSPQgven---------------------------- 602  Caenorhabditi...
232011        575 EKYEGATVLEPIKGYYIEPISTLDFASLYPSIMIAHNLCYSTLIKSNHevsdlq-------------------------- 628  Plasmodium fa...
XP_766420     570 NSYEGATVLEPLKGYHKNPISVLDFQSLYPSIMIAHNICYSTLLNYNTinnyk--------------------------- 622  Theileria par...
XP_638283     585 EKFQGAIVIEPTPGFYDTPIATLDFTSLYPSIMMAHNLCYSTLLSAEEakklp--------------------------- 637  Dictyostelium...
XP_654477     529 DKYVGATVINPIKGFYKVPISTLDFSSLYPSIMISHNLCYSTLIDGIKtrkdipsieflktseseedrklydqimkklkd 608  Entamoeba his...
CAM40726      510 RGYEGATVIDPIKGFYNCPVATLDFASLYPSIIIAHNLCYSTLVRPADarlyp--------------------------- 562  Leishmania br...
XP_001326973  517 DQYQGATVIEPSTGYYTTPIPTLDFNSLYPSIMIGHNICYSTLMTKPDpnv----------------------------- 567  Trichomonas v...
XP_001443230  428 QEYQGAFVLDPVKNFYKVPIATLDFASLYPSIMMAHNMCYSTLLNTSPfkvgl--------------------------- 480  Paramecium te...
XP_955596     462 KTFEGGFVIEPRKGFYNKPVSVMDFSSLYPSIMISHNLCYTTLLTKEQyri----------------------------- 512  Encephalitozo...
XP_001032353  573 DKFEGAFVLQPKKGFYDKPIATLDFASLYPSIMMAHNLCYSTLISKNVamsmn--------------------------- 625  Tetrahymena t...
Feature 1                                                #                           #   #        
P90829        603 -----edyIRTP--SGQYFATKSKRRGLLPEILEDILAARKRAKNDMKN-EKDEFKRMVYNGRQLALKISANSVYGFTGA 674  Caenorhabditi...
232011        629 --nddittIQGK--NNLKFVKKNVKKGILPLIVEELIEARKKVKLLIKN-EKNNITKMVLNGRQLALKISANSVYGYTGA 703  Plasmodium fa...
XP_766420     623 ----pediVTVPgyNDICFINVKKRKGILPIIVENLINERKKAKKMMNE-CKDEMLKKVYDGRQLALKITTNSVYGYTGA 697  Theileria par...
XP_638283     638 ----peiyTTTP--FGDHFIKSDTKKGLLPRILEELLSARKKAKDELKN-EKDPFKRAVLDGRQLALKISANSVYGFTGA 710  Dictyostelium...
XP_654477     609 kqlnvedvELSP--NGDLFVKSSKRKGILPEILENLLAARKQAKKDMAA-ATDPFKITVLNGRQLALKVSANSVYGFTGA 685  Entamoeba his...
CAM40726      563 ----edalDRSP--TSDVFVKKDVFPGILPEVLQDLLAARKHARAMMKDvPMHSLEYKVLNGRQLALKVSANSVYGFTGA 636  Leishmania br...
XP_001326973  568 ------qyEKSP--NHCFFAKHDEFPGVLPEILKELLAARKATKKLMEE-ATDPMQKKVFDKRQLALKISANSVYGFTGA 638  Trichomonas v...
XP_001443230  481 ---adeqvTVSPe-TNAIFVKPNVRKGMLPLILEDLINARKKAKNQLAQ-ETDPFKKAVLDGRQLALKISANSVYGFTGA 555  Paramecium te...
XP_955596     513 -----lggTKTP--TGNYFCSAERKKGLLPRILTDLLTSRKRIKEELER-EKDSALRACLNGRQLAFKLCANSLYGFTGA 584  Encephalitozo...
XP_001032353  626 ----kddyTLTP--HGDYFAKPHVRQGILPDILKDLLAARKKAKNELAK-ETDPLRKAVLDGRQLALKISANSVYGFTGA 698  Tetrahymena t...
Feature 1                                                               #                         
P90829        675 TVG-KLPCLEISQSVTAFGRKMIDMTKLEVERIYKkgaldgkcpaDAKVIYGDTDSVMVK-------FGVETVAQAMEIG 746  Caenorhabditi...
232011        704 SSGgQLPCLEVAVSITTLGRSMIEKTKERVESFYCksng---yehNSTVIYGDTDSVMVK-------FGTNNIEEAMTLG 773  Plasmodium fa...
XP_766420     698 TSGgFLPCIDVATAITSFGRNMIVNTKDLIEEHFSrkng---fkfDSKVIYGDTDSVMIN-------FGTDDIQEAIDLG 767  Theileria par...
XP_638283     711 RVG-KLPCLEISRSVTSFGREMLDKTKKIVEERYTiang---ykhDAVIIYGDTDSVMVK-------FGVKTVAEAMEMG 779  Dictyostelium...
XP_654477     686 QIG-KLPCMQIASSVTSYGRTMIELTKTTVEEKYSkkng---fpwDAQVVYGDTDSVMVK-------FGTSDLAEAIRLG 754  Entamoeba his...
CAM40726      637 QVG-KLPCLEISASVTAYGRQMIDKTKNLVEQLYP----------GTRVLYGDTDSVMVKcvtdekaSDKERLQAAMDFG 705  Leishmania br...
XP_001326973  639 TVG-KLPCLQISESVTAYGRSMIEMTKELVENKYNkqng---ysdDAHVIYGDTDSVMVN-------FGNITLEEAIKRG 707  Trichomonas v...
XP_001443230  556 QVG-QLPCLEISASITSFGRQMIQFTRDTVLEHYSkkng---aefDAEVIYGDTDSVMVK-------FGDYSVEKAMALG 624  Paramecium te...
XP_955596     585 SRG-KLPCFEISQSVTGFGREMIILTKKLIEENFSrkng---ythDSVVIYGDTDSVMVD-------FDEQDIEKVFKMS 653  Encephalitozo...
XP_001032353  699 QVG-QLPCLEISSSVTSFGRQMIEATRDFVLNHYNkang---ynyDSDVIYGDTDSVMVK-------FGCDSIEEAMKYG 767  Tetrahymena t...
Feature 1                                                                                         
P90829        747 LDAAKEVSKI-FTPPIKLEFEKVYSPYLLINKKRYAGLYFTKPDVHDKMDCKGLETVRRDNCPLVAKVLGVCLEKLLIER 825  Caenorhabditi...
232011        774 KDAAERISKE-FLSPIKLEFEKVYCPYLLLNKKRYAGLLYTNPNKHDKMDCKGIETVRRDFCILIQQMMETVLNKLLIEK 852  Plasmodium fa...
XP_766420     768 KSAADLITSK-SVRPITLLFEKVYKPLLLLSKKRYAGLYYVNSENYEKIDCKGIESVRRDFCLLIQQMLEKILYLLLVKL 846  Theileria par...
XP_638283     780 RDAAKFVTTT-FIRPINLDFEKVYYPYLLMAKKKYAGLYWTKPDIHDRMDVKGLEMVRRDTCLLVRNVVSTILKKILIEK 858  Dictyostelium...
XP_654477     755 KEAAVFVTTK-FPRPINLEFEKVFFPYLLISKKRYAGLYFNRADKWDHVDTKGIETVRRDNCLLVKYVIENVLNKILLDS 833  Entamoeba his...
CAM40726      706 IEAAERVSSD-FLKPIKLEFEKVYFPYLLMNKKRYAGLLWTNTDQFDKLDAKGIETVRRDNCPLVARMVSGVLNRILIHR 784  Leishmania br...
XP_001326973  708 KEAANYVSDH-FPPPIHIDFEKAYKPYLLISKKHYAGLLWTNHIKYDKIDAKGIEAVRRDNCRLVQGLVQKVLTLLLVKE 786  Trichomonas v...
XP_001443230  625 REAAALISKK-FIQPIKLEFEKVYYPYLLMNRKRYAGQLWTKPDKPDKIDTKGIESVRRDNCFLIRKMVTEILNFLLIKQ 703  Paramecium te...
XP_955596     654 KEISEFITSK-FVKPVSLEFEKVYYPYLLINKKRYAGLLYSNPENPSKIDTRGIETVRRDNCRLVKEVVETVLEMILYQK 732  Encephalitozo...
XP_001032353  768 KEAAEMISKKlFINPIKLEFEKVYYPYLLISKKRYAGCFYTKPDKYDKIDTKGMENVRRDNCQFIREMMNTCLRYILVEH 847  Tetrahymena t...
Feature 1                                                                                         
P90829        826 DQQ---SALDFAKRTISDLLCNKIDISLLIISKELTKsg------------------------------dKYQAKQAHVE 872  Caenorhabditi...
232011        853 NLN---SAIEYTKSKIKELLTNNIDMSLLVVTKSLGKt--------------------------------DYETRLPHVE 897  Plasmodium fa...
XP_766420     847 DLD---GAIEFVKQKVSELLKNDIDVSLLVITKTLGKv--------------------------------DYEQRLPHVE 891  Theileria par...
XP_638283     859 DLK---SAEEYTKSVISDLLQNRLDLSMLVITKALSKt--------------------------------QYKGKVIHNE 903  Dictyostelium...
XP_654477     834 DVE---GAISFVKNMISDLLQNKLDLSMLIISKTLSKe--------------------------------DYAGKQAHVE 878  Entamoeba his...
CAM40726      785 SVE---SAIDFVKGTISDLLLNRLDISNLVITKAFSKae------------------------------dEYAGAQAHIA 831  Leishmania br...
XP_001326973  787 DPG---SAKVFVKKIVSDLVSDHIDLSFLVISKGLSKka------------------------------dQYKGKQAHVE 833  Trichomonas v...
XP_001443230  704 DEK---SAVQYTKEQIRNLYLNKVDISELVITKSLNSkkedkdnnnnnnnnnnkekkknqneddgnkltkNYKQKQAHVV 780  Paramecium te...
XP_955596     733 NVE---KAKQFVKDAVRDLYLGRTDLSLLVISKSLTKag------------------------------dKYESKQAHVQ 779  Encephalitozo...
XP_001032353  848 KQDgvqRSIQFIKGCISDLYQNKVDISKLVITKSLTKksadddegeedgkk-----gsshnnkakepsanQYKGKQAHVE 922  Tetrahymena t...
Feature 1                                                                                 
P90829        873 LAARMKKRDaGSAPRLGDRVPYVFVAAakNVPAYERAEDPTFVLQNNIPLDTKHYLTNqlAKPLARIFEPIL 944  Caenorhabditis elegans
232011        898 LAKKLKQRDsATAPNVGDRVSYIIVKGvkGQAQYERAEDPLYVLDNNLAIDYNHYLDAi-KSPLSRIFEVIM 968  Plasmodium falciparum...
XP_766420     892 LAKKLRKRDpGKAPGVGDRISYIIVKGtkGEPLFDRAEEPLYVTENNLPIDTNYYLDSl-KNVLLRIFEVVM 962  Theileria parva strai...
XP_638283     904 LARKMRARDpATAPNLGDRVPYVVIQGskGAPIYEKAEDPLYALEHNILLDCQYYLDKqlKAPLIRIFKPIM 975  Dictyostelium discoid...
XP_654477     879 LVKRIRERDkTTTINTGDRIPYVIIKStkDAKAYEKAEDPLYVLENNIPIDFDYYIENqlKKPLTRIFKPIL 950  Entamoeba histolytica...
CAM40726      832 LVERMRQRDpASAPTIGDRVAYVIIKAakGAKAYERSEDPIYVLDNNIPIDTQYYLEHqlAPPILRVFEGVL 903  Leishmania braziliensis
XP_001326973  834 LADRMMKRDpGSAPRMGDRIPFVMCDVgnGAKGYEKSEDPIWALEHSIPIDTKYYLENqlSGPLNRLFGPII 905  Trichomonas vaginalis G3
XP_001443230  781 VAEKMQNRDaSNAPSAGDRIAYIIIQGakGTKTYENAEDPVEVLEKDFPIDFDYYVNNqiKKPIMRLFEFVI 852  Paramecium tetraurelia
XP_955596     780 LAEKLRKRDeSTAPVLGDRVPYVIVRKekGAAAHEKSEDPVYVLENNLPIDTEYYISQqiSKPLSRIFEPIM 851  Encephalitozoon cunic...
XP_001032353  923 LAKKMAKRDpGSAPCIGDRIPYVIVAGakSAKNYEKVEDPIYVLENDIPLDYDYYIEKqiKNPITRIYSHII 994  Tetrahymena thermophi...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap