Conserved Protein Domain Family
POLBc_alpha

?
cd05532: POLBc_alpha 
DNA polymerase type-B alpha subfamily catalytic domain. Three DNA-dependent DNA polymerases type B (alpha, delta, and epsilon) have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase (Pol) alpha is almost exclusively required for the initiation of DNA replication and the priming of Okazaki fragments during elongation. In most organisms no specific repair role, other than check point control, has been assigned to this enzyme. Pol alpha contains both polymerase and exonuclease domains, but lacks exonuclease activity suggesting that the exonuclease domain may be for structural purposes only.
Statistics
?
PSSM-Id: 99915
View PSSM: cd05532
Aligned: 35 rows
Threshold Bit Score: 467.826
Threshold Setting Gi: 123425608
Created: 23-May-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active sitemetal-binding
Feature 1:active site [active site]
Evidence:
  • Comment:Based on similarity to bacteriophage RB69 POLBc (1Q9Y)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                     #  ###                                              
P26019        852 QTKKKAAYAGGLVLEPMRGLYEKYVLLMDFNSLYPSIIQEYNICFTTVQQPVdadelp---------------------- 909  fruit fly
XP_001610630  790 SDSKKKNYEGGLVLEPETGLYDNFVLLLDFNSLYPSIIQEFNVCFTTVKLLEdgsv------------------------ 845  Babesia bovis
XP_954899     620 QLDDMKSYEGGLVFEPISGLYDNFILLLDFNSLYPSIIQEYNICFTTTVAKDednv------------------------ 675  Theileria ann...
XP_626972     832 NSKKEETYSGGLVLEPITGLYDSFILLLDFNSLYPSIIQEFNICFTTREPTDlgpdatetfess---------------- 895  Cryptosporidi...
AAB28217     1019 KNKNTAKYLGGLVLDPLCGYYDTFVLYLDFNSLYPSIIIEYNVCFSTLKLKNcdvsiednklntkkngninndyeknihs 1098 malaria paras...
XP_001013747  787 PKKKENKYKGGQVFEPEKGLYNEYIVLLDFNSLYPSIIQEFNVCFTTCVRDPiplemqmapflgnkkaaiqysknqntke 866  Tetrahymena t...
XP_001446457  684 EQESKKTYGGGLVFEPKADIYTQYVLLLDFNSLYPSIIMEYNICFTTVQRDKinfevdktqleeeptqtkpqksnknk-- 761  Paramecium te...
NP_597442     396 VSRREVKYSGGLVLPPQTGFYEDLVLLLDFNSLYPSIIQEFNVCFSTIGMFDrsisgnmsseq----------------- 458  Encephalitozo...
XP_640277     882 DKDNHAAYSGGLVLDPKIDFYDRYVVLLDFNSLYPSIIQEYNVCFTTINRVKrddgkwee-------------------- 941  Dictyostelium...
XP_001582431  695 PKSKLGKYRGATVLQPKKGFYDTIIVLLDFTSLYPSIISEYNLCFTTVDKRNpnsee----------------------- 751  Trichomonas v...
Feature 1                                                                           #             
P26019        910 ------------------------------------------tlpdskTEPG--ILPLQLKRLVESRKEVKKLMAAPdls 945  fruit fly
XP_001610630  846 --------------------------------------------qvltETTG--MLPQILKRLVELRASVKAAIAVEk-n 878  Babesia bovis
XP_954899     676 ---------------------------------------------viqDNVG--VLPSILKRLVELRLNIKNIIKGEk-n 707  Theileria ann...
XP_626972     896 -------------------------------------slidrnsssnqFDST--VLPGILESLVKRRRHIKEILKNMp-s 935  Cryptosporidi...
AAB28217     1099 daeknihsdddknihsddeknydndksynkleddnllennveidefdrSKPG--ILPCILKSLVEKRSVIKKLISNEk-n 1175 malaria paras...
XP_001013747  867 ---------------------nkmqdedeedneneqivqthdvlptieVIKGiaPLPSILQYLVEQRKVVKNQIKGQk-d 924  Tetrahymena t...
XP_001446457  762 ----------------------kkkdqtqdendtkekikdfigsvdpdAGSG--ILPQIIEKLVNMRKQAKKEMSRSt-- 815  Paramecium te...
NP_597442     459 --------------------------------------lvrltedaknSERG--FLPRILEGFVRRRKAVKDLLKQGg-t 497  Encephalitozo...
XP_640277     942 -----------------------------------------ampppssIEKG--ILPKVLHGLVSKRREIKKRMEQEk-n 977  Dictyostelium...
XP_001582431  752 --------------------------------------------avncGRKG--ILPEIMENLTKMRIELKNKMNTLqdd 785  Trichomonas v...
Feature 1                       #   #                                                  #          
P26019        946 PELQMQYHIRQMALKLTANSMYGCLGFAHSRFFAQHLAALVTHKGREILTNTQQLVQkm-nyDVVYGDTDSLMINTNI-- 1022 fruit fly
XP_001610630  879 DSRKAQLGVRQLALKLVANSLYGCLGSVYSRFHARHMAAYITQQGRLVLQSTRERVEnqyslHVIYGDTDSLMIDTNIrd 958  Babesia bovis
XP_954899     708 EVRRVQLSTRQLALKLIANSIYGCLGSNFSRFHCKYIASYITKLGRELLRSTKEKVEnvfnlQVIYGDTDSLMINTNIrd 787  Theileria ann...
XP_626972     936 GTRKSQLEIRQLALKLTANSLYGCLGYKNSRFYAKDLASIITFYGRQILQKTKLKVEdetklQVIYGDTDSIMVNTNIld 1015 Cryptosporidi...
AAB28217     1176 KEKKELLLIQSLSIKLISNSIYGCLGNTNNRFYAKHLASYITSKGRNLLQHTKFKVEkefnlKVIYGDTDSIMIDTGIka 1255 malaria paras...
XP_001013747  925 PQVIETLDIKQKAFKLVANSMYGCLGFSSSRFYAMPLASFITAKGRHILFDSKKIVEdm-gySVIYGDTDSLMIKPGT-- 1001 Tetrahymena t...
XP_001446457  816 GLMKQIYNIKQLAVKLVANSIYGCLGFSSSRFYAVGIASLITQKGRSILMDSKNTVErs--nDVIYGDTDSMMICARQe- 892  Paramecium te...
NP_597442     498 PEETKALDIRQKALKLTANSIYGCLGFVGSRFCNYTMAAYITSKGRDLLLEAKRIAEgecgvRIIYGDTDSVMVHTGLag 577  Encephalitozo...
XP_640277     978 KIIKAQYDIQQQAVKLIANSMYGCLGFSHSRFYALPLAELVTRKGRENLQKGASIVNkm-cyDVIYGDTDSLMIYTGV-- 1054 Dictyostelium...
XP_001582431  786 KFNFDRFLIKQQAIKSLSNSIYGYLGFSLSRFASNEIAALITERGRFVLQKTVETVEslgkfSVIYGDTDSVMVNTGT-- 863  Trichomonas v...
Feature 1                                                                                         
P26019       1023 ----TDYDQVYKIGHNIKQSVNKLYK--QLELDIDGVFGCLLLLKKKKYAAIKLSkdsk------gnlrREQEHKGLDIV 1090 fruit fly
XP_001610630  959 dgseTSYEAAKQIANTLMSSINKSHK--KLEIGMDAMFNRLLLLKKKKYAALKVVdyk--------sriFAREIKGLDFI 1028 Babesia bovis
XP_954899     788 dgnlANYNAANQLANNLVTFINKSHK--KLEIGIDAVFTRLLLLKKKKYASLKVIeye--------tgqFAREIKGLDFI 857  Theileria ann...
XP_626972    1016 dgngEGYYHVLKLASQIKQIVNKDYT--KLELDLDGVLQRLLLLKKKKYACIQIVdfh--------rkqLKLECKGLDLV 1085 Cryptosporidi...
AAB28217     1256 n-niNNYKESFKLAHLIKNSINKNYK--KLELDLECIFSKLLLLKKKKYACAKVIdnn--------lekYEYEMKGINFI 1324 malaria paras...
XP_001013747 1002 ----NEFLEAVKTGLSIKIKVNSKYK--KLQLDIDGVFKNMLLLKKKKYATLKVAnweevkn-tnapekLEKEIKGIDVV 1074 Tetrahymena t...
XP_001446457  893 ----KNLSEILVLGTQIAKEINKKYK--KLVLAIDGVFDTLLLMKKKKYAGIKIDnledlmtgqteqpkFKMEVKGIDIV 966  Paramecium te...
NP_597442     578 --kkSNYTKALELSRRLQDAINSRYK--KIEIEVDKVFKKLLLYKKKRYAGLYMTdd----------gkGRIEYKGLDLV 643  Encephalitozo...
XP_640277    1055 ----GTFNEAETIGKEIQKKINDQYRgsVMEIGLDGIFKRLLLFKKKKYACLKEFrids------tttkCERENKGIDIV 1124 Dictyostelium...
XP_001582431  864 ----KSVEEAKKIANDISEKVTKQYK--FLKLTVSGLFTKMLLVAKKKYAVTVYDdd----------nkCHREVKGLDMV 927  Trichomonas v...
Feature 1                                                                                         
P26019       1091 RRDWSQLAVMVGKAVLDEVLSekpl--------------------eekLDAVHAQLEKIKTqiae--------------- 1135 fruit fly
XP_001610630 1029 RRDWSILTKEVGNALLAIILNdkvndpe-------------elgventVEKIHETLRDVNNkiae--------------- 1080 Babesia bovis
XP_954899     858 RRDWSLLTKEIGNKLLDIILNsnyyn-----------------gvdgiVQEIHSTLINLNDqlnn--------------- 905  Theileria ann...
XP_626972    1086 RRDWSILTRNVSTQLLNLLFSnepi--------------------dtvITNILNTLESLNEalns--------------- 1130 Cryptosporidi...
AAB28217     1325 KRDFSKISKLIGNEVLRIIFTnrdvdskni----------pvplendlSEQIHEYLRTINQriqn--------------- 1379 malaria paras...
XP_001013747 1075 RRDWCQLSRDAGNKILEIILEskss--------------------enmLDDIKKYLIQLNDdinq--------------- 1119 Tetrahymena t...
XP_001446457  967 RREFCDISKKMQSHVLDILLKtk------------------------nRDDIHGDLITLMQeirsmfdalsgnsnad--- 1019 Paramecium te...
NP_597442     644 RKDFCEVSRKICRIVLELLLAdcedpetyrrfyegepkmvlndgsikiREAVYDELRKVSSdle---------------- 707  Encephalitozo...
XP_640277    1125 RRDYCDLTKDIGQWVLNLILGgeek--------------------ialFSLIKEYLESVQQqikd--------------- 1169 Dictyostelium...
XP_001582431  928 RRDWCQLTKYLSSFVLDQMMNnddrslt-------------vrnclseFHNVAKLLRKSNNdeqnslfyydenfslhnks 994  Trichomonas v...
Feature 1                                                                                         
P26019            --------------------------------------------------------------------------------      fruit fly
XP_001610630      --------------------------------------------------------------------------------      Babesia bovis
XP_954899         --------------------------------------------------------------------------------      Theileria ann...
XP_626972         --------------------------------------------------------------------------------      Cryptosporidi...
AAB28217          --------------------------------------------------------------------------------      malaria paras...
XP_001013747      --------------------------------------------------------------------------------      Tetrahymena t...
XP_001446457      --------------------------------------------------------------------------------      Paramecium te...
NP_597442         --------------------------------------------------------------------------------      Encephalitozo...
XP_640277         --------------------------------------------------------------------------------      Dictyostelium...
XP_001582431  995 nkndvdkkndkinsnenekqnsknelksdkinskendkensknsvnenesksetkdkinsnenddeqksvnflsksdtes 1074 Trichomonas v...
Feature 1                                                                                         
P26019       1136 --------------------------------------gvvPLPLFVITKQLTRTPQEYANsaSLPHVQVALRMnrern- 1176 fruit fly
XP_001610630 1081 --------------------------------------gniPPKAWIITRQLAKNPQEYGQnnNLPHVTVALRMnesg-- 1120 Babesia bovis
XP_954899     906 --------------------------------------nsiELSKFLITKQLTKNPKEYSDvqNLPHVSVALRLnekgh- 946  Theileria ann...
XP_626972    1131 --------------------------------------nsiPLESFIITKTLTKLPQFYSDpyLLPHVIVAKRMissg-- 1170 Cryptosporidi...
AAB28217     1380 --------------------------------------defDLDYYIITKKLTKNVHEYQDknSLGHVLVAERMikdg-- 1419 malaria paras...
XP_001013747 1120 --------------------------------------kniKNSNYYITKRLTKRVDQYGEk-NLPHVAVAQRSiqekgi 1160 Tetrahymena t...
XP_001446457 1020 --------------------------pkqliaqnrfityeiPTSDFIIVKQLNKAPHEYSDtiSAPHVQVALRMvneygr 1073 Paramecium te...
NP_597442     708 ---------------------------------------giPAREFVIHNTLSKAPESYDAcaALPHVSLALRLkerg-- 746  Encephalitozo...
XP_640277    1170 --------------------------------------ntlAVEKFIITKTLSKQPEEYNDadIQPHVQVALQMrakg-- 1209 Dictyostelium...
XP_001582431 1075 ssipnyqevksyssslksdksdtksdgeesnssksfhlkkiTKEMLIIYRQLNKKISEYSDkrNNPHVSIALRMmkrg-- 1152 Trichomonas v...
Feature 1                                                                                         
P26019       1177 -rrykKGDMVDYVICLDgttn----------------------aamqRAYHLDElkts-----------edkKLQLDTNY 1222 fruit fly
XP_001610630 1121 -asfsAGHEVPFIICSKesieklvlqdnaesnekkteldvklrslcnRAYSLTEfq--------------qkGLEPDIQY 1185 Babesia bovis
XP_954899     947 -anysTGHEISYIICTKssaskfhtnsdnsae-ntsssgntgsslssRAFSYNEvt--------------enGLEVDISY 1010 Theileria ann...
XP_626972    1171 -lpvsSGTEIPYIICKEvnsqssdev------------apkssmlskRAYSPEEvk--------------snGLNIDIEW 1223 Cryptosporidi...
AAB28217     1420 -ynicVNKEIQYCVCTSed--------------------------asRFYKKTSeklnnsqccfsineikkyNLKIDKEY 1472 malaria paras...
XP_001013747 1161 dpqtyVNQIISYIICKNeqsklffvdscmv----niqrekwwlllvdKAYSPQEfit------------qskSLEIDLQY 1224 Tetrahymena t...
XP_001446457 1074 saqslVNHFIRYVICEDptqk----------------------nlsfRAYTVDEli--------------nkNLTIDYYY 1117 Paramecium te...
NP_597442     747 -mkfeQGDVVCYVIGKGdpgq----------------------aihkRAYHPDE------------------DFAIDYGY 785  Encephalitozo...
XP_640277    1210 -lhvqPGEQVPYIITHGnsssdi------------------keewhhRARAPSDve---------------sIQDVDIDW 1255 Dictyostelium...
XP_001582431 1153 -ekvpQHATIPMIVTSPdvre-----------------------lcdKVKLPDEvk---------------dMSEIDSQW 1193 Trichomonas v...
Feature 1                                         
P26019       1223 YLGHQIHPVVTRMVEVLEGTDASRIAECLGMD 1254 fruit fly
XP_001610630 1186 YKTQQLLPPILRLCGVIEGTDPQKLASCLQIQ 1217 Babesia bovis
XP_954899    1011 YKQQQLLPPILRLCSIIEGTDIQRLSRCLQIE 1042 Theileria annulata strain Ankara
XP_626972    1224 YKTQQLLPPLSRLCAPIPGLEISRIGQCLGLE 1255 Cryptosporidium parvum Iowa II
AAB28217     1473 YIRNQILSPINRLCQYIEGTSAEKLSSCFNIY 1504 malaria parasite P. falciparum
XP_001013747 1225 YKRFQLFEPIKRMLEVIEGINLQEIASILEVH 1256 Tetrahymena thermophila SB210
XP_001446457 1118 YLSTQIFDPIVRLCKNVQVISISELAQILGLK 1149 Paramecium tetraurelia
NP_597442     786 YISSQILPPLLRVVGIVKGFHAGKIGKIFGVE 817  Encephalitozoon cuniculi GB-M1
XP_640277    1256 YLSQQILPSIQRNTGPIGMEPHELAQWLGMTG 1287 Dictyostelium discoideum AX4
XP_001582431 1194 YLVNQILPPIIRLFAPYEHVGSSTIGRSLGLT 1225 Trichomonas vaginalis G3

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap