1S5J


Conserved Protein Domain Family
POLBc_B1

?
cd05530: POLBc_B1 
Click on image for an interactive view with Cn3D
DNA polymerase type-B B1 subfamily catalytic domain. Archaeal proteins that are involved in DNA replication are similar to those from eukaryotes. Some archaeal members also possess multiple family B DNA polymerases (B1, B2 and B3). So far there is no specific function(s) has been assigned for different members of the archaea type B DNA polymerases. Phylogenetic analyses of eubacterial, archaeal, and eukaryotic family B DNA polymerases are support independent gene duplications during the evolution of archaeal and eukaryotic family B DNA polymerases.
Statistics
?
PSSM-Id: 99913
View PSSM: cd05530
Aligned: 10 rows
Threshold Bit Score: 637.857
Threshold Setting Gi: 18313158
Created: 20-Jul-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitemetal-binding
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Based on similarity to bacteriophage RB69 POLBc (1Q9Y)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                        #  ###                                          
1S5J_A       447 NIRTSALIKGKGYKGAVVIDPPAGIFFNITVLDFASLYPSIIRTWNLSYETVDIQqckkpyevkdeTGEVLHIVCMDRPG 526  Sulfolobus sol...
BAA07579     520 TTRSEALIKGKKYQGALVLDPPSGIYFNIVVLDFASLYPSIIKRWNLSYETVNPVycpes--klveVPDVGHKVCMSIPG 597  Pyrodictium oc...
YP_001040880 461 PSTTQATIEGKKYAGALVIEPPKGVFFKVTVLDVASLYPSIIKKYNLSYETVDKPnckskidildeTGKKIHHVCIDKPG 540  Staphylothermu...
YP_919711    439 QTSTKAIIKGKKYLGAIVINPKPGVYFNVVVVDFASLYPSVIKTWNLSYETVRCQhkec---menrVPGTNHWVCKKRRG 515  Thermofilum pe...
NP_559825    473 QTHTKAIIKGKKYAGAVVLDPPLGIFFDVYVLDFASLYPSIISKWNLSYETVNCRpda-----erpIPELPHTVCHDKPG 547  Pyrobaculum ae...
O93745       568 GARVGAIIKDKKYRGAIVLDPPVGIFFRVLVLDFASLYPSLIKQWNLSYETVNNPncrd----tieVPEVGHRVCREFKG 643  Aeropyrum pern...
AAC62689     452 QVSNDAVIKDKKFRGGLVVEPEEGIHFDVTVMDFASLYPSIIKVRNLSYETVRCVhpec---rkntIPDTNHWVCTKNNG 528  Cenarchaeum sy...
BAE95222     463 HASTTAVIKDKKYRGGFVVEPKPGVHFNVVVLDFASLYPSIIKVYNLSYETVRCVheec---ktniIPETEHWVCKKRKG 539  uncultured cre...
ABU81872     524 TVKSSAIIKGKSYQGAFVFEPSAGIFFNVVVLDFASLYPTIIKQYNISYETVNAPkckn----yyeVPEVGHRICKDVEG 599  Ignicoccus hos...
YP_001737609 436 RTYSQAIIKGKKYMGAIVLEPIPGIHFDVAVMDFASLYPSIIGRWKVSFETINCPhedcr--enrpVNELPHWICKKERG 513  Candidatus Kor...
Feature 1                    #                            #   #                                  
1S5J_A       527 ITAVITGLLRDFRVKIYKKKAKNpnnsEEQKLLYDVVQRAMKVFINATYGVFGAETFPLYAPRVAESVTALGRYVITSTV 606  Sulfolobus sol...
BAA07579     598 LTSQIVGLLRDYRVKIYKKKAKDkslpDDVRAWYNTVQAAMKVYINASYGVFGAESFPFYAPPVAESVTAIGRYTIKQTL 677  Pyrodictium oc...
YP_001040880 541 LSAQITGLIRDFRVGIYKKKAKSkeipIEMRAWYDVVQKAMKVFINASYGVFGAENFPLYSPAVAESVTALGRKSLYSIL 620  Staphylothermu...
YP_919711    516 LMSEIIGILRDLRVYVYKKGAKSsk-nEEERQQYDVIQSALKVFLNASYGVFGSEAFPLYCPPVAESTTALGRYSILKTM 594  Thermofilum pe...
NP_559825    548 LTSTLVGILRDLRVHVYKKLAKKap-tPAERQLYDVVQSAMKVFINASYGVFGAETFPLYCPPVAELTTALARYIMTSTV 626  Pyrobaculum ae...
O93745       644 ISNEIVGMLRDFRVRLYKKKSKDkslrEEERLWYDVVQSAMKVYINASYGVFGSEKFSLYSLPVAESVTALGRAVLRGTL 723  Aeropyrum pern...
AAC62689     529 LTSMIIGSLRDLRVNYYKSLSKSqsitEEQRQQYTVISQALKVVLNASYGVMGAEIFPLYFLPAAEATTAVGRYIIMQTI 608  Cenarchaeum sy...
BAE95222     540 ITSLLIGSLRDLRVNYYKQLSKDktlkPEDKELYSVISQALKVILNASYGVMGADIFPLYCLPVAEATAAIGRYIITSTI 619  uncultured cre...
ABU81872     600 ITSQIVGLLRDYRVKIYKKKAKDksldDKMKMWYDTVQSAMKVYINASYGVLGAESFELYCPPAAESITAYGRFAIKSTM 679  Ignicoccus hos...
YP_001737609 514 IVPYLIQALRDLRVKRYKRRAKEek-dENMREWFDTVQRSLKVFLNASYGVFGYENFPLYSPPAAEMITALARKAMLLSI 592  Candidatus Kor...
Feature 1                       #                                                                
1S5J_A       607 KKAREEGLTVLYGDTDSLFLLNPPKNSLENIIKWVKTtFNLDLEVDKTYKFVAFSGLKKNYFGVYQDGKVDIKGMLVKKR 686  Sulfolobus sol...
BAA07579     678 QKAGELGLRVLYGDTDSLFIWNPDEDKLRELQEYVEKnFGLDLEVDKVYKFVTFSGLKKNYIGAYEDGSIDVKGMVAKKR 757  Pyrodictium oc...
YP_001040880 621 KKSAEIGMKVVYGDTDSIFLWAPTNEQLTKLQEWVSKnLGLEIEVDKEFVYVLFTGLKKNYIGRYVNGGIEIKGLMAKKR 700  Staphylothermu...
YP_919711    595 QKAVEMGIPVLYGDTDSLFLWNPPQEKLEELLQNILNeLQIDLSIDKEYLWVVFSKRKKNYLGLLKERKVDIKGLTGKKR 674  Thermofilum pe...
NP_559825    627 LKAIELGLIPVYGDTDSLFLWNVSEEKLKKLVEYTEE-LGIDIELDKIYKFVMFSGRKKNYLGVTNDGSVIVKGIVAKKR 705  Pyrobaculum ae...
O93745       724 EKSRELNLHIVYGDTDSLFIWDPPKDVLNDLVDYVERtYGLELELDKVFRAILFSGLKKNYLGITEEGDIVIKGMVAKKS 803  Aeropyrum pern...
AAC62689     609 SHCEQMGVKVLYGDTDSLFIKNPEERQIHDIVEHAKKeHGVELEVDKEYRYVVLSNRKKNYFGVTKSGKVDVKGLTGKKS 688  Cenarchaeum sy...
BAE95222     620 KKCKELGIEVIYGDTDSLFLKGPSREQIESIAKWARKeLGVDLDLDKQYRYIALSERKKNYLGVLIDGNVDVKGLTGKKS 699  uncultured cre...
ABU81872     680 DYAKKNKIAVLYGDTDSMFLWDPPQNLLDDIIEWVKNnFGLEIEIDKTYRFVAFTGLKKNYIGVYPGGEIDVKGLLGKKR 759  Ignicoccus hos...
YP_001737609 593 DEARRMNLSVIYGDTDSLFIRGATQGQIEEFERRVEEkLGIDLELDKWYRYVVFSRLKKNYLGVTKDGSVVIKGLLGKKR 672  Candidatus Kor...
Feature 1                                                                                        
1S5J_A       687 NTPEFVKKVFNEVKELMISinspndvKEIKRKIVDVVKGSYEKLKNKGYNLDELAFKVMLSKPLDAYKKNTPQHVKAALQ 766  Sulfolobus sol...
BAA07579     758 NTPEFLKKEFSEMLAVIGSvkspedfIKVRRVIRERLRKVYHGLRDLEFNLDELAIRMALNKPVEAYTKNTPQHVKAARQ 837  Pyrodictium oc...
YP_001040880 701 NTPEFLKQLFIELIEKLKAmstpedfKEFQEWLENEVKRLYRELKKKEITLDQLAFKVGLTKSLNEYTKNKPPHVKAALQ 780  Staphylothermu...
YP_919711    675 NTPDYIKNLFNEIVEDLSEadnvsefEKSVDKIRDLVFTAIQRLKKHEVPLDQLAFKVALTKPLKEYTKTTPQHVKAARQ 754  Thermofilum pe...
NP_559825    706 NAPPIVKELVEEIINALRNinsvediSKVRETVIAMVKEVETRIREKKITLDKLGIKIVLNKNLNEYTKNKPQHVKAAEQ 785  Pyrobaculum ae...
O93745       804 NTPEFIKDEFSKAVKILSKlekpedvEAILAELRDHINTVYNNVKKKVYTLDQFAIKVMLSKNPREYDKNTPQHVKAAML 883  Aeropyrum pern...
AAC62689     689 HTPPFIKELFYSLLDILSAvqtedefESAKLKISKAIAASGKRLEERGVPLADLAFNVMISKAPSEYVKTVPQHIRAARL 768  Cenarchaeum sy...
BAE95222     700 HTPQFVRDAFYAVVDILSKvnteqdfEYAREEIRRIIKDYAGRLKSRKIPLEDLAFNVMVGKAPEDYKKTMPQHIRAAQL 779  uncultured cre...
ABU81872     760 NTPQFVKEAFIKMIEMIRNsqspeevVKTREEVKNLVKELYMNLKRQYYDLDELAFHMQLTKPIESYTKNMPQHVKAAKM 839  Ignicoccus hos...
YP_001737609 673 NIPILVKEAFDEVIKTLSEvrspedfSNAKMKIEEIIRGYVKMLESGDYDLEKLAFRCMLGKSPEDYTKTTPQHVKVARI 752  Candidatus Kor...
Feature 1                                                                     
1S5J_A       767 LRPfg------vNVLPRDIIYYVKVRSKDGVKPVQLAKVTEIDAEKYLEALRSTFEQILRA 821  Sulfolobus solfataricus
BAA07579     838 LIRag------vQVLPGDVISFVKVKGKEGVKPVQLARLPEVDVEKYVESMRNVFEQLLLA 892  Pyrodictium occultum
YP_001040880 781 LKTyg------yTVEEGDIITFVKIKGREGYKAIQLAKLYEVDPDKYIEIINSALSQLLEA 835  Staphylothermus marinus F1
YP_919711    755 LLEyrsklgisgNVEVGEIIAYVKTRNKDGVKAVQVARIDEVDNDKYIEIMRTTLQQILDA 815  Thermofilum pendens Hrk 5
NP_559825    786 LLKyg------iNVGRGDAIIIIKTKDAVGVKPIQLARIDEIDEKKYLEYISTSLEQILEA 840  Pyrobaculum aerophilum str. IM2
O93745       884 LQRlg------lTLSRGDIVYYVKTRDKLGVKPVQLARLSDVDPGKYVEHVKTAFEQMLMA 938  Aeropyrum pernix K1
AAC62689     769 LENa-------rEVKKGDIISYVKVMNKTGVKPVEMAQAGEVDTSKYLEFMESTLDQLTSS 822  Cenarchaeum symbiosum
BAE95222     780 LQDqg-----krEVKAGDIISFVKTTTPPGVKPVELARVDEVDVEKYIEYMRTTFDQILGA 835  uncultured crenarchaeote 31-F-01
ABU81872     840 LAKfg------iHVNQGDVVSFVKVKGAEGVKPVQLAKLPEVDVEKYYEAIESTLGQILKA 894  Ignicoccus hospitalis KIN4/I
YP_001737609 753 LESmg------kRVEAGQVIKYVKVIGREGVMPVELASKSQIDKEKYVEIMRSTFEQILGA 807  Candidatus Korarchaeum cryptofilu...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap