Conserved Protein Domain Family
Bromo_ASH1

?
cd05525: Bromo_ASH1 
Bromodomain; ASH1_like sub-family. ASH1 (absent, small, or homeotic 1) is a member of the trithorax-group in Drosophila melanogaster, an epigenetic transcriptional regulator of HOX genes. Drosophila ASH1 has been shown to methylate specific lysines in histones H3 and H4. Mammalian ASH1 has been shown to methylate histone H3. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99955
View PSSM: cd05525
Aligned: 10 rows
Threshold Bit Score: 140.217
Threshold Setting Gi: 109465072
Created: 13-Sep-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                         #         #  #                                  
AAF68983     2443 ARLAQIFKEICDGIISYkdssrqaLAAPLLNLPPK-----KKNADYYEKISDPLDLITIEKQILTG---YYKTVEAFDAD 2514 human
BAE06763      231 TLLRDAINDVFTAVMTCkdengvsVAIPFINLPSK-----TQNPEYYDHVTDPVDLSFVEQKIVTK---EYENFQEFCVD 302  Ciona intesti...
XP_001122948 1695 AKLAKVLKDLYSIVATAkdendqlLCTPFITLPSK-----RKLPDYYEKISDPIDLSTIDQCIGTG---HYKTAEHFDHD 1766 honey bee
XP_971447    1091 VKLAAVLREIWNTVTKAkdennesLSTHFMTMPSK-----RKVPEFYQRITNPIDLATIEQNIATG---YYLAPESFNSD 1162 red flour beetle
EAT38426     1589 ARIAVALKEICIEIASLkde-rghLYLNRLTLPSK-----KKVPLYYERIPRPIDLAQIQSNIDQG---TYKQPKAFEED 1659 yellow fever ...
XP_227409    2432 ARLAQIFKEICDGIISYkdsysvlIYNKXINLKKKkrereRNELXNFQIPVTTWWLTTICKEIXCPllvYLKTATVYSSK 2511 Norway rat
Q9VW15       1680 AKMAVVLRDICSAMETLkmsdlltTVSSKKKKPIKt---tLSGKLGSTAATSKVEFRSIQAQVEQG---HYKTPQEFDDH 1753 fruit fly
XP_422858    2428 ARLAQIFKEICDSIIAYkdssrqaLAAPLLNLPPK-----KKNADYYEKISDPLDLATIEKQILTG---YYKTVEAFDGD 2499 chicken
CAK04992     2357 ARLAHIFKEICDMITSYkdssgqpLAAPLLNLPSR-----KRNTQYYEKVTDPLDLSTIDKQILSG---HYKTDEAFDAD 2428 zebrafish
XP_784903    2790 ARLAQVFKDIYTAVCTYrnpsgqsLAIPFMNLPSK-----KRNPDYYKRISDPVDLSTIEKNLMTG---KYKSVEAFDSD 2861 purple urchin
Feature 1                #   #     #                
AAF68983     2515 MLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARH 2548 human
BAE06763      303 LQRVFRNAEKYHGRKSTLGRDVARLRRSFACARS 336  Ciona intestinalis
XP_001122948 1767 MIKLFDNNVRFFGRTSEMGIAAARLRKLYLGSKP 1800 honey bee
XP_971447    1163 MNRMFANYLQFYGRTKEIGVAAIKLKKVYVDAKQ 1196 red flour beetle
EAT38426     1660 LLIMLSNAVKYYGISSPEGVASEKLKEHYYICKQ 1693 yellow fever mosquito
XP_227409    2512 MISFFCFLQKYYGRKSPIGRDVCRLRKAYYSARH 2545 Norway rat
Q9VW15       1754 MQQLFVEAKQQHGDDEGKEKALQSLKDSYEQQKI 1787 fruit fly
XP_422858    2500 MLKVFRNAEKYYGRKSPTGRDVCRLRKAYYNARH 2533 chicken
CAK04992     2429 MLKVFRNAEKYYGRKSAVGRDVCRLRKAYYGARH 2462 zebrafish
XP_784903    2862 FLKVFKNSEKYNGKRSDLGKDAAVLRKIYLTAKA 2895 purple urchin

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap