2DAT,2H60,2GRC


Conserved Protein Domain Family
Bromo_SNF2L2

?
cd05516: Bromo_SNF2L2 
Click on image for an interactive view with Cn3D
Bromodomain, SNF2L2-like subfamily, specific to animals. SNF2L2 (SNF2-alpha) or SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 is a global transcriptional activator, which cooperates with nuclear hormone receptors to boost transcriptional activation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99947
View PSSM: cd05516
Aligned: 12 rows
Threshold Bit Score: 181.857
Threshold Setting Gi: 39593716
Created: 13-Sep-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
acetyllysine
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:acetyllysine binding site
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                          #    #  #                      
2DAT_A         13 KLTKQMNAIIDTVINYKDs------------------SGRQLSEVFIQLPSRkeLPEYYELIRKPVDFKKIKERIRNHKY 74   human
19857556     1425 RSKKQMHKIMSAVIKHNQ-------------------DGRTLSEPFMKLPSRqrLPDYYEIIKRPVDIKKILQRIEDCKY 1485 fruit fly
AAX08100     1409 KLTKKMKKIVDAVIKYKEs-----------------sDGRQLSEVFIQLPSRkeLPEYYELIRKPVDFRKIKERIRNHKY 1471 African clawe...
NP_853634    1439 SLTKKMKKTVDAVIKYKDg------------------NGRQLSEVFIQLPSRkeLPEYYELIRKPVDFRKIKERIRSHKY 1500 zebrafish
P51531       1378 KLTKQMNAIIDTCINYKDscnvekvpsnsqleiegnsSGRQLSEVFIQLPSRkeLPEYYELIRKPVDFKKIKERIRNHKY 1457 human
CAE62008     1216 ELARSVNDMIAVILVYEDd------------------GGYRIADPFKKLPTRreLPEYYQIIATPMDFDRLKRKLSTGRY 1277 Caenorhabditi...
XP_001640179 1321 DLTKKMKRLLKYVVKHVDe-----------------dTGRSLAEPFLILPTKkdLPDYYQIIKQPVDIRKIRERINSHKY 1383 starlet sea a...
3879468      1181 ELAEKINEMLDVILEYKNe------------------DGELIADVFQTLPTRkeLPDYYQVISKPMDFDRINKKIETGRY 1242 Caenorhabditi...
2H60_A          7 NLTKKMKKIVDAVIKYKDs-----------------sSGRQLSEVFIQLPSRkeLPEYYELIRKPVDFKKIKERIRNHKY 69   human
2GRC_A         11 NLTKKMKKIVDAVIKYKDs-----------------sSGRQLSEVFIQLPSRkeLPEYYELIRKPVDFKKIKERIRNHKY 73   human
996020       1378 KLTKQMNAIIDTVINYKDs------------------SGRQLSEVFIQLPSRkeLPEYYELIRKPVDFKKIKERIRNHKY 1439 chicken
XP_794091    1478 HLTKLMKKLVEVMSKYKDn------------------TGRPLAHPFMQLPPKriLPDYYELITKPMDLKKIKDRIRQHKY 1539 purple urchin
Feature 1                         #   #     #                  
2DAT_A         75 RSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQSG 119  human
19857556     1486 ADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQKVFVGARQRI 1530 fruit fly
AAX08100     1472 RSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 1516 African clawed frog
NP_853634    1501 RSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 1545 zebrafish
P51531       1458 RSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKI 1502 human
CAE62008     1278 QTLEDVNTDMELLVNNAQIFNQEGSELYENSKIIGKLWKEQYDKI 1322 Caenorhabditis briggsae
XP_001640179 1384 RCLEDLDEDFTLMCRNAQTYNMEGSIIFDDSIKLQSLFDHAMSKV 1428 starlet sea anemone
3879468      1243 TVMEELNDDMNLLVNNAQTYNEEGSEIYVSSETIGKLWKEQYDKF 1287 Caenorhabditis elegans
2H60_A         70 RSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 114  human
2GRC_A         74 RSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 118  human
996020       1440 RSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKI 1484 chicken
XP_794091    1540 RCLDDLERDTVLMFQNAQIYNLEGSQIYDDSIVLHSVFTTARKCL 1584 purple urchin

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap