Conserved Protein Domain Family
Bromo_SPT7_like

?
cd05510: Bromo_SPT7_like 
Bromodomain; SPT7_like subfamily. SPT7 is a yeast protein that functions as a component of the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA, and SLIK. SAGA is involved in the RNA polymerase II-dependent transcriptional regulation of about 10% of all yeast genes. The SPT7 bromodomain has been shown to weakly interact with acetylated histone H3, but not H4. The human representative of this subfamily is cat eye syndrome critical region protein 2 (CECR2). Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99942
View PSSM: cd05510
Aligned: 7 rows
Threshold Bit Score: 184.182
Threshold Setting Gi: 66813688
Created: 14-Sep-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                         #    #  #                                    
2104460    296 QRIGQEELYEAAEKVVLELRSYt---EHSLAFLTKVSKRDAPDYYTVIKEPMDLGTILRNLKNLHYNSKKEFVHDLMLIW 372  fission yeast
XP_641023  304 KSEAQEEMYDQLDTVLNQLKDYs---DHSFPFLTKVRPSEAPNYYEIIKKPMDLSLMTKKLKKLEYQSKFEFQLDLNLIF 380  Dictyostelium di...
EAL22597    18 VKISADAFYESLENIVNELKTS----PESIPFQKPVSKREAPDYYDVIKRPMDLSTILRNAKARKYKSKAEFAADLDLIW 93   Cryptococcus neo...
464802     438 ERIGQEELYEACEKVVLELRNYt---EHSTPFLNKVSKREAPNYHQIIKKSMDLNTVLKKLKSFQYDSKQEFVDDIMLIW 514  baker's yeast
XP_760612   32 GRDEREEFLESIDRIITELKNYt---EHSTAFLSKVSKRDAPDYYDVIKHPMDLGTMQKKVKSGQYKNKKQFAHDLNLIW 108  Ustilago maydis 521
XP_959920  339 ENVGQEELYEALDKVLTELKAHt---EYSTPFLTKVNKRDAHDYYNIIKQPMDLGTMAKRLKTLHYKSKAEFVTDLNLIW 415  Neurospora crass...
EAU92016    35 DTKLSDPFYESLDNLLADLRTItidnRDAEAFLKPVSRVEVPDYYDYITNPMDLGTMAKKVKNKQYKSKREFKDDLDLIW 114  Coprinopsis cine...
Feature 1        #   #       #                     
2104460    373 SNCFLYNSHPd-HPLRVHAQFMKDKSLELINLIPDI 407  fission yeast
XP_641023  381 TNCRIYNTDPsgKVYVEHANKMEKKSKDLMKNVKDL 416  Dictyostelium discoideum AX4
EAL22597    94 KNCFEYNSQEs-HPLRAAARFMKQKADHHLEYLADR 128  Cryptococcus neoformans var. neoformans B-3501A
464802     515 KNCLTYNSDPs-HFLRGHAIAMQKKSLQLIRMIPNI 549  baker's yeast
XP_760612  109 ENCLLYNSDPt-HPLRRNVAFMRKKADHLLEFISDK 143  Ustilago maydis 521
XP_959920  416 DNCLRYNQDLa-NPLRRMANGMRKEAEKLIPLIPDI 450  Neurospora crassa OR74A
EAU92016   115 SNCYKYNAAEd-HPLRQCVDRLKAKAERLLKHITDR 149  Coprinopsis cinerea okayama7#130

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap