Conserved Protein Domain Family
Bromo_plant1

?
cd05506: Bromo_plant1 
Bromodomain, uncharacterized subfamily specific to plants. Might function as a global transcription factor. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99938
View PSSM: cd05506
Aligned: 13 rows
Threshold Bit Score: 179.063
Threshold Setting Gi: 113565491
Created: 13-Sep-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                              #      #  #                                       #   # 
NP_189362  176 LMKQCDTLLRKLWSHPHSWVFQAPVDVVKLNIPDYLTTIKHPMDLGTVKKNLASGv-YSSPHEFAADVRLTFTNAMTYNP 254  thale cress
NP_913322  142 VFKSCGALLARLMKHKHSWVFNTPVDASALGLHDYHTIITKPMDLGTVKSRLAAGh-YKSPREFAGDVRLTFQNAMRYNP 220  Japanese rice
AAT71928   161 VMKECETLLNRLWSHKSGWPFRTPVDPVMLNIPDYFNVIKHPMDLGTIRSRLCKGe-YSSPLDFAADVRLTFSNSIAYNP 239  thale cress
NP_199467   69 WSSQCLALLRFLMEHRGGWLFKEPVDPVKMEIPDYFNVIQKPMDLGTVKSKLLKNv-YSNADEFAADVRLTFANAMHYNP 147  thale cress
AAO84020   168 AFKQCEAILKKLMTQKYSHIFNVPVDIVKLQIPDYFDIVKTPMDLGTVKKKLESGs-YTSPSDFAADVRLTFNNAMAYNP 246  Zea mays
NP_196617  249 MMTTCGQILVKLMKHKWSWVFLNPVDVVGLGLHDYHRIVDKPMDLGTVKMNLEKGl-YRSPIDFASDVRLTFTNAMSYNP 327  thale cress
BAF15834     1 MRKRCDQILAKLRKDKRSIWFNAPVEVDRLGLQDYHAVIKCPMDLGTVRANLAAGr-YPSHDDFAADIRLTFSNALRYNP 79   Japanese rice
AAC12830   110 LMRQFATMFRQIAQHKWAWPFLEPVDVKGLGLHDYYKVIEKPMDLGTIKKKMESSe-YSNVREIYADVRLVFKNAMRYNE 188  thale cress
CAN72911    70 TTLQCTSILKXLMTHPAGWVFNQPVDPVALNIPDYFSIISKPMDLGTIKSKLEKNx-YLATEEFAADVRLTFANAMLYNP 148  wine grape
CAL52374   134 VHKQCLTSVRQLIAHKWGFPFAAPVDPDALDLPTYREIIKEPMDLGTVKNLIENGgkYVKAEEVDADVRLTFANAMKFNA 213  Ostreococcus tauri
BAD08859   162 AFKQCGNLLKNLFKHQWAGPFLAPVDVVQLNIPDYFDIIKKPMDLGTIEKKLNAGm-YSTPWDFAADVRLTFDNAVTYNP 240  Japanese rice
EAZ04001    61 KSRQCGSILKKLMDHKSGWIFNTPVDPVVYGIPDYFDVIRNPMDLGTVKRKLTSKq-YSNPYEFAADVRLTFSNAMKYNP 139  Indian rice
EAY75177   104 ALLRCGKLLDKLLEHEDGWVFAEPVDARALRLVDYYLRISDPMDLGTVRRRLERRc-YADPWAFAADVRLTFNNAMSYNS 182  Indian rice
Feature 1          #               
NP_189362  255 PGhDVHIMGDILSKLFEARW 274  thale cress
NP_913322  221 KGqDVHFMAEQLLNMFEEKW 240  Japanese rice
AAT71928   240 PGnQFHTMAQGISKYFESGW 259  thale cress
NP_199467  148 LWnEVHTIAKEINEIFEVRW 167  thale cress
AAO84020   247 RGhAVHDMAIQLNKMFESRW 266  Zea mays
NP_196617  328 KGqDVYLMAEKLLSQFDVWF 347  thale cress
BAF15834    80 AGhEVHTFAGDLLASFEKMY 99   Japanese rice
AAC12830   189 EKeDVYVMAESLLEKFEEKW 208  thale cress
CAN72911   149 PSnNVHQMAKKLNDLFNTRW 168  wine grape
CAL52374   214 EGtDVHAMAKELLVEWETRW 233  Ostreococcus tauri
BAD08859   241 VGnDVNLMGKTLKCIFETRW 260  Japanese rice
EAZ04001   140 PGnDVHAIADQLNKIFDSEW 159  Indian rice
EAY75177   183 AGdPVYESAAELSEIFEAGW 202  Indian rice

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap