Conserved Protein Domain Family
Bromo_Acf1_like

?
cd05504: Bromo_Acf1_like 
Bromodomain; Acf1_like or BAZ1A_like subfamily. Bromo adjacent to zinc finger 1A (BAZ1A) was identified as a novel human bromodomain gene by cDNA library screening. The Drosophila homologue, Acf1, is part of the CHRAC (chromatin accessibility complex) and regulates ISWI-induced nucleosome remodeling. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99936
View PSSM: cd05504
Aligned: 11 rows
Threshold Bit Score: 197.618
Threshold Setting Gi: 16768864
Created: 13-Sep-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                  #    #  #                                   
XP_426440         1411 NRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFMKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIEDIELM 1490 chicken
BAA89209          1540 GRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELM 1619 human
CAB43261           677 GRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELM 756  human
AAL60160           494 NRRSSGRHHGVHELSACEQLVVELVRHDDSWPFMRLVSKNQVPDYFDVIQRPIALNLIREKVNKCEYKCASEFIDDVHLM 573  African ...
XP_395223         1180 IEQEEDKGTIKGSLGRLQELLSDIKQHRDSWPFLSPVTKDEVPDYHDIISNPMDFGTIKYKLNNNEYETLEHFFSDCHLV 1259 honey bee
EAA06826          1285 RRSRRTGDDLPLNSVALYTLIDDILKHPNSWPFNRPVSAKEVPDYYAVIKSPMDFARIKSKLNMGDYKINEQMLSDVQLV 1364 Anophele...
FlyBase:CG1966-PA 1349 RSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLV 1428 fruit fly
AAL28651           273 RSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLV 352  fruit fly
XP_971434         1177 TRRDEGRTDLPLHNSALHAVLSEVMKDANAWPFLRPVQKIEVPDYYDVITKPMDFGTIKYKLNMGEYKEDAQFMADALLV 1256 red flou...
XP_001604290      1245 EHEEEIKHTVKGCKHLLTQLLAEIKKNKDSWPFMAPVTKDEVPDYHDYISHPMDFGTIKTKFENDEYRTLQEFYSDCLLV 1324 jewel wasp
CAF89628          1417 SRRSSGRSHGLHQLSTCEQLVVELVRHPDSWPFMKLVSRTQVPDYYDIIQKPIALNTIREKVNNYKYQSAGEFVSDVRLM 1496 Tetraodo...
Feature 1                 #   #     #                     
XP_426440         1491 FSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLP 1525 chicken
BAA89209          1620 FSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLH 1654 human
CAB43261           757 FSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLH 791  human
AAL60160           574 WSNCFEYNHHNSNEAKAGIRLQSFFITEAQNLGLE 608  African clawed frog
XP_395223         1260 FENCQAYNEEHSSVYNYVYRAGMRLLKYYEKRCKE 1294 honey bee
EAA06826          1365 FRNCDLYNTDETDVYRIGRDLERYVVKRCKELNLP 1399 Anopheles gambiae str. PEST
FlyBase:CG1966-PA 1429 FRNCDLYNVEGNEIYDAGCQLERFVIDRCRDMQLP 1463 fruit fly
AAL28651           353 FRNCDLYNVEGNEIYDAGCQLERFVIDRCRDMQLP 387  fruit fly
XP_971434         1257 FQNCNTYNHTEDDVYKCGVQLLRLFQKKCRELGLK 1291 red flour beetle
XP_001604290      1325 FDNCQTYNTEHSEVYKAGMRLMKFFEKKCKDLNLN 1359 jewel wasp
CAF89628          1497 FSNCFQYNPRHTSEAKAGLRLQLFFNSELRKLAPP 1531 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap