Conserved Protein Domain Family
Bromo_WDR9_II

?
cd05496: Bromo_WDR9_II 
Bromodomain; WDR9 repeat II_like subfamily. WDR9 is a human gene located in the Down Syndrome critical region-2 of chromosome 21. It encodes for a nuclear protein containing WD40 repeats and two bromodomains, which may function as a transcriptional regulator involved in chromatin remodeling and play a role in embryonic development. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99928
View PSSM: cd05496
Aligned: 6 rows
Threshold Bit Score: 226.185
Threshold Setting Gi: 91094543
Created: 13-Sep-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                      #    #  #                                      #   
AAF56278     1371 HSEGDWRADCRQLLDLMWARTDSAPFREPVDTIDFPDYLEIIATPMDLRTVKEDLLGGNYDDPLDFAKDVRLIFQNSKNY 1450 fruit fly
AAH70018      620 LDINAWHKQCKDLVRRMIVSSDSEPFRQPVDLFTYPDYRDIIDTPMDLGTVSETLTGGNYENPIEFAKDVRLIFSNSKAY 699  zebrafish
Q9NSI6       1313 YVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAY 1392 human
XP_972653    1159 RHASDWKSEAKILFQAIWDCEDSVPFRTPVNNLKYTDYHDIIETPMDLSTVKDKLFSDKYETPNEFYNDMRLIFQNSRTY 1238 red flour beetle
XP_416730    1314 YDENCWKKQCMELVNLIFQCEDSEPFRQPVDLDQYPDYRHIIDTPMDFGTVKETLEAGNYDTPMELCKDIRLIFSNAKSY 1393 chicken
XP_001201169 1362 YNSKAWIEQCKKLLKDMWDCHDSEPFRTPVDERAYPDYRGIIDHPMDLSTLKQQFALGSYRDPMDLGKDVRLMFTNAKSF 1441 purple urchin
Feature 1         #      #                               
AAF56278     1451 NTNKRSRIYAMTLRLSALFESHIKTVVTSWKAALRRANK 1489 fruit fly
AAH70018      700 TPNKKSRIYSMTLSLSAFFENQIIPIISDYKSAVQNQRR 738  zebrafish
Q9NSI6       1393 TPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEK 1431 human
XP_972653    1239 NTNKRSRIYVMTVRLAAIFEEHISKLIKHWKMAKRRSYA 1277 red flour beetle
XP_416730    1394 TPNKKSKIYSMTLRLSALFEEKIRRIVSDFKNGQKQNEK 1432 chicken
XP_001201169 1442 TPNKKSRIYGMTLRLSAVFEEHFLKIIGSYRSALKYEKQ 1480 purple urchin

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap