1JSP


Conserved Protein Domain Family
Bromo_cbp_like

?
cd05495: Bromo_cbp_like 
Click on image for an interactive view with Cn3D
Bromodomain, cbp_like subfamily. Cbp (CREB binding protein or CREBBP) is an acetyltransferase acting on histone, which gives a specific tag for transcriptional activation and also acetylates non-histone proteins. CREBBP binds specifically to phosphorylated CREB protein and augments the activity of phosphorylated CREB to activate transcription of cAMP-responsive genes. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99927
View PSSM: cd05495
Aligned: 13 rows
Threshold Bit Score: 198.822
Threshold Setting Gi: 78057533
Created: 12-Sep-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
acetyllysine
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:acetyllysine binding site
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                     #      #  #                                      #  
1JSP_B         11 PEELRQALMPTLEALYRQdPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWL 90   human
AAH86282     1078 PEELRQALMPTLEALYRQdPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVEDVWLMFNNAWL 1157 African clawe...
BAE02656      978 PDELRQALMPTLEKLVKQdPESLPFRQPVDPVILHIPDYFEIVKKPMDLSTIRRKLDSGLYKDPWEYVDDVWLMFDNAWL 1057 great pond snail
1916930      1699 PEELRTALLPTLEKLYRQePESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWL 1778 fruit fly
FAA00132      228 PNELLQVLMPIVEKLFKQdPESIPFRYPVDPDRLNIPDYYDIVKNPIDLTTIRKKLEVGEYQEPWEFVNDVWLMFHNAWL 307  Ciona intesti...
AAZ57334      690 REELLRHFLQLHEEVYND-KYAEPFRAPVDPVMLHIPDYFQVIKEPMDLTTIRNNLEDGKYTDPWQVVDHFRLMFNNAWL 768  Schistosoma m...
ABB17266      413 SNELLQHFLPVVLKISKE-KDAEPFLTPVDWKFLEIYDYPQIVSDPMDLSTIRRKLEDREYKDPWEIVDDFWLMLNNAWL 491  Schistosoma m...
20455476      866 QEDLIKFLLPVWEKLDKS-EDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWL 944  Caenorhabditi...
XP_001632816  667 PEELRLALMPTLEKLYKQePESLPFRSPVDPKLLGCLDYFEIVRNPMDLSTIKRKLDNGQYKNPWEYCDDVWLMFDNAWL 746  starlet sea a...
XP_414964    1086 PEELRQALMPTLEALYRQdPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWL 1165 chicken
NP_001082924  744 PEELRQALMPTLESLYRQdPESLPFRQPVDPILLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWL 823  zebrafish
XP_782558    1296 PDELRQALMPTLEKLYRQnPESLPFQQPVDPHKLQIPDYFDIVKTPMDLQTIKNKLDTGQYIDPWQFVDDVWLMFDNAWL 1375 purple urchin
EDP35982      953 ANELRNNLKPVVDKLLSM-EESIPFRIPVDPDILGIPDYFDIVKKPMDLSTVSRKLDTGEYKNPWDFNDDMWLMFDNAWL 1031 agent of lymp...
Feature 1          #     #                    
1JSP_B         91 YNRKTSRVYKFCSKLAEVFEQEIDPVMQ 118  human
AAH86282     1158 YNRKTSRVYKYCTKLAEVFEQEIDPVMQ 1185 African clawed frog
BAE02656     1058 YNRKTSRVYKYASKLAEVFESEIDSVMQ 1085 great pond snail
1916930      1779 YNPKTSRVYRYCTKLSEVFEAEIDPVMQ 1806 fruit fly
FAA00132      308 YNRKTSRVYKYCTRLKEIFEQEIDPVMQ 335  Ciona intestinalis
AAZ57334      769 YNKKTSKVYKMCTKLAELFQNRIDQVMQ 796  Schistosoma mansoni
ABB17266      492 YNKKTSKVYKTCTRVISYFLRLHVSLSL 519  Schistosoma mansoni
20455476      945 YNRKNSKVYKYGLKLSEMFVSEMDPVMK 972  Caenorhabditis elegans
XP_001632816  747 YNRKTSRVYKYCTKLSEVFESEIDPVMK 774  starlet sea anemone
XP_414964    1166 YNRKTSRVYKFCTKLAEVFEQEIDPVMQ 1193 chicken
NP_001082924  824 YNRKTSRVYKYCSKLAEVFEQEIDPVMQ 851  zebrafish
XP_782558    1376 YNRKTSRVYKYCTKLAEVFEQEIDPVMQ 1403 purple urchin
EDP35982     1032 YNRKNSKVYKYCNKLSEVFVEEINPVMQ 1059 agent of lymphatic filariasis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap