1G0V,1DP5


Conserved Protein Domain Family
Proteinase_A_fungi

?
cd05488: Proteinase_A_fungi 
Click on image for an interactive view with Cn3D
Fungal Proteinase A , aspartic proteinase superfamily.
Fungal Proteinase A, a proteolytic enzyme distributed among a variety of organisms, is a member of the aspartic proteinase superfamily. In Saccharomyces cerevisiae, targeted to the vacuole as a zymogen, activation of proteinases A at acidic pH can occur by two different pathways: a one-step process to release mature proteinase A, involving the intervention of proteinase B, or a step-wise pathway via the auto-activation product known as pseudo-proteinase A. Once active, S. cerevisiae proteinase A is essential to the activities of other yeast vacuolar hydrolases, including proteinase B and carboxypeptidase Y. The mature enzyme is bilobal, with each lobe providing one of the two catalytically essential aspartic acid residues in the active site. The crystal structure of free proteinase A shows that flap loop is atypically pointing directly into the S(1) pocket of the enzyme. Proteinase A preferentially hydrolyzes hydrophobic residues such as Phe, Leu or Glu at the P1 position and Phe, Ile, Leu or Ala at P1'. Moreover, the enzyme is inhibited by IA3, a natural and highly specific inhibitor produced by S. cerevisiae. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA).
Statistics
?
PSSM-Id: 133155
View PSSM: cd05488
Aligned: 10 rows
Threshold Bit Score: 606.356
Threshold Setting Gi: 50294061
Created: 9-Jan-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic residue [active site]
Evidence:
  • Comment:The two ASPs at the active site plays key catalytic roles in the pepsin family and conserved for all family members.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                    #                                                   
1G0V_A         5 VPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGY 84  baker's yeast
AAW41068     117 VPLSNYMNAQYFATMEIGTPFQTFKVILDTGSSNLWVPSVKCTSIACFLHSKYDSSQSSTYKANGSDFEIHYGSGSLEGF 196 Cryptococcus ne...
AAA79878      75 VPITNFMNAQYFSEITIGTPPQTFKVVLDTGSSNLWVPSSQCGSIACYLHNKYESSESSTYKKNGTSFKIEYGSGSLSGF 154 Neurospora crassa
XP_505932     73 SPLTNYLNAQYYTEIEIGTPPQKFNVILDTGSSNLWVPSVQCNSIACYLHQKYDSAASSSYKANGTAFEIQYGSGSMEGF 152 Yarrowia lipoly...
XP_001645003  76 VPLDNYLNAQYYTDVSIGTPPQKFKVILDTGSSNLWVPSVGCSSLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGSLKGY 155 Vanderwaltozyma...
XP_761073     97 VPLTDFLNAQYFCDISLGTPAQDFKVILDTGSSNLWVPSTKCSSIACFLHKKYDSSASSSYKKNGTEFKIQYGSGSMEGI 176 Ustilago maydis...
EAU84813      89 VPLTNFMNAQYYTEITLGTPPQTFKVILDTGSSNLWVPSIKCTSIACFLHTKYDSSQSTTYKANGTEFSIQYGSGSMEGF 168 Coprinopsis cin...
XP_449442     81 VPLSNYMDAQYFADISLGTPPQKFKVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGY 160 Candida glabrat...
XP_001729651  96 VPLTDFLNAQYFADIELGSPPQSFKVILDTGSANLWVPSESCTSIACLLHKKYDNSLSKTYQANGSEFQIHYGSGSMEGF 175 Malassezia glob...
1DP5_A         5 VPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGY 84  baker's yeast
Feature 1                                                                                        
1G0V_A        85 ISQDTLSIGDLtipKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEkRFAFYLGdtsk--- 161 baker's yeast
AAW41068     197 ISQDTVSIGDLvvkKQDFAEATKEPGLAFAFGKFDGILGLGYDTISVNHIVPPFYNMLNQHLLDEpVFSFRLGssd---- 272 Cryptococcus ne...
AAA79878     155 VSQDRMTIGDItinDQLFAEATSEPGLAFAFGRFDGILGLGYDRLAVPGITPPFYKMVEQKLVDEpVFSFYLAdq----- 229 Neurospora crassa
XP_505932    153 VSQDTLKLGSLvlpEQDFAEATSEPGLAFAFGKFDGILGLAYDTISVNKIVPPVYNAVNRGLLDKnQFSFFLGdtnk--- 229 Yarrowia lipoly...
XP_001645003 156 ISQDTLTIGDLiipQQDFAEATAEPGLAFAFGKFDGILGLAYDSISVNKAVPPLYNAIHRGLLDKpMFAFYLGdeks--- 232 Vanderwaltozyma...
XP_761073    177 VSNDVLKIGDLtikGQDFAEATSEPGLAFAFGKFDGILGLAYDTISVNGIVPPMYQMINQGLLDApQVSFYLGsse---- 252 Ustilago maydis...
EAU84813     169 VSQDTLGIGDLtikGQDFAEALKEPGLAFAFGKFDGILGLAYDTISVNRIVPPFYNMINQKLIDSpVFAFRIGsse---- 244 Coprinopsis cin...
XP_449442    161 ISEDNLQIGDLtiqNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAIQQHLLDEsKFSFYLKsvndpaa 240 Candida glabrat...
XP_001729651 176 VSRDTLRIGDLdvkDQDFAEAIKEPGLAFAFGKFDGILGLAYDTISVNKIVPPFYRMKEQNLLDQnQFGFYLGsse---- 251 Malassezia glob...
1DP5_A        85 ISQDTLSIGDLtipKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEkRFAFYLGdtsk--- 161 baker's yeast
Feature 1                                                                    #                   
1G0V_A       162 ---dtenGGEATFGGIDeskFKGDITWLPVRRKAYWEVKFEGIGLGD-EYAELESHGAAIDTGTSLITLPSGLAEMINAE 237 baker's yeast
AAW41068     273 -----edGGEAIFGGIDdsaYSGELQYVPVRRKGYWEVELESISFGD-EELELENTGAAIDTGTSLIVMPTDVAELLNKE 346 Cryptococcus ne...
AAA79878     230 -----dgESEVVFGGVNkdrYTGKITTIPLRRKAYWEVDFDAIGYGK-DFAELEGHGVILDTGTSLIALPSQLAEMLNAQ 303 Neurospora crassa
XP_505932    230 ----gtdGGVATFGGVDedyFEGKITWLPVRRKAYWEVEFNSITLGD-QTAELVNTGAAIDTGTSLLALPSGLAEVLNSE 304 Yarrowia lipoly...
XP_001645003 233 ----sknGGEATFGGYDpsrFEGEIKWLPVRRKAYWEVQFDGIKLGD-KFMKLEGHGAAIDTGTSLITLPSQIADFLNNE 307 Vanderwaltozyma...
XP_761073    253 -----edGGEAVFGGIDdshYTGKIHWSPVKRKGYWEVALDKLALGD-EELELDNGSAAIDTGTSLIAMATDTAEILNAE 326 Ustilago maydis...
EAU84813     245 -----edGGEATFGGIDheaYTGKLHYVPVRRKAYWEVELEKISFGD-DELELEHTGAAIDTGTSLIALPTDMAEMLNTQ 318 Coprinopsis cin...
XP_449442    241 eggsasdGGVFTLGGVDsskFKGDLIPLHVRRQAYWEVPLNAIKLGDqSTGKLENTGAAIDTGTSLITLPSDMAEIINAQ 320 Candida glabrat...
XP_001729651 252 -----seGGEATFGGVDpsrFEGPIVYAPVRRRGYWEVALNKIGFGN-EELVLTRTGAAIDTGTSLIAMPTDVAEILNKE 325 Malassezia glob...
1DP5_A       162 ---dtenGGEATFGGIDeskFKGDITWLPVRRKAYWEVKFEGIGLGD-EYAELESHGAAIDTGTSLITLPSGLAEMINAE 237 baker's yeast
Feature 1                                                                                        
1G0V_A       238 IGAKKGSTGQYTLDCntrdnLPDLIFNFngYNFTIGPYDYTLEvSGSCISAITPMDFPEPVGp-LAIVGDAFLRKYYSIY 316 baker's yeast
AAW41068     347 IGAEKSWNGQYTVDCstvssLPVLAFTFggKDYKLTGDDYILNaGGTCISSFTGMDIPAPIGp-LWIVGDVFLRKYYTVY 425 Cryptococcus ne...
AAA79878     304 IGAKKSWNGQFTIDCgkkssLEDVTFTLagYNFTLGPEDYILEaSGSCLSTFMGMDMPAPVGp-LAILGDAFLRKYYSIY 382 Neurospora crassa
XP_505932    305 IGATKGWSGQYTVECdkvdsLPDLTFNFagYNFTIGPRDYTLElSGSCVSAFTGFDIPAPVGp-IAIIGDAFLRRYYSVY 383 Yarrowia lipoly...
XP_001645003 308 IGAKKSWNGQYTIDCkkresLPKLTLNFynHNFTIDPFDYTLEiSGSCISAITPMDFPQPVGp-LSIIGDAFLRRFYSIY 386 Vanderwaltozyma...
XP_761073    327 IGATKSWNGQYSVDCekvkdLPPLTFYIdgQPFKLEGKDYVLEvQGSCISSFSGINLPGPLAd-MLIVGDVFLRKYYSVY 405 Ustilago maydis...
EAU84813     319 IGARKSWNGQYQVDCnkvpsLPDLTFQFggKPYPLKGSDYILNvQGTCISAFTGMDINMPGGdsLWIVGDVFLRKYYTVY 398 Coprinopsis cin...
XP_449442    321 IGAKKGWTGQYTLECstrakLPDLTFTLdgHDFVLSPFEYTLEvSGSCISVITPMDFPEPIGr-MAILGDAFLRRYYSVF 399 Candida glabrat...
XP_001729651 326 IGAKRSWTGQYSVDCskvpsLPALTFYLdnKPYTLEGRDYIFNvQGTCISPFMGMDLPEPVGp-LWIVGDVFLRKFYTVY 404 Malassezia glob...
1DP5_A       238 IGAKKGWTGQYTLDCntrdnLPDLIFNFngYNFTIGPYDYTLEvSGSCISAITPMDFPEPVGp-LAIVGDAFLRKYYSIY 316 baker's yeast
Feature 1                   
1G0V_A       317 DLGnNAVGLAK 327 baker's yeast
AAW41068     426 DLGkNAVGFAK 436 Cryptococcus neoformans var. neoformans JEC21
AAA79878     383 DLGaDTVGIAT 393 Neurospora crassa
XP_505932    384 DLDhDAVGLAK 394 Yarrowia lipolytica CLIB122
XP_001645003 387 DLEnNAVGLAK 397 Vanderwaltozyma polyspora DSM 70294
XP_761073    406 DLGkNAVGLAT 416 Ustilago maydis 521
EAU84813     399 DLGnDAVGFAP 409 Coprinopsis cinerea okayama7#130
XP_449442    400 DLDaNVVSLAE 410 Candida glabrata CBS 138
XP_001729651 405 DLDkDAVGFAK 415 Malassezia globosa CBS 7966
1DP5_A       317 DLGnNAVGLAK 327 baker's yeast

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap