1U8X


Conserved Protein Domain Family
GH4_GlvA_pagL_like

?
cd05298: GH4_GlvA_pagL_like 
Click on image for an interactive view with Cn3D
Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases.
Bacillus subtilis GlvA and Clostridium acetobutylicum pagL are 6-phospho-alpha-glucosidase, catalyzing the hydrolysis of alpha-glucopyranoside bonds to release glucose from oligosaccharides. The substrate specificities of other members of this subgroup are unknown. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP_PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases, which include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. Members of this subfamily are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Statistics
?
PSSM-Id: 133434
View PSSM: cd05298
Aligned: 22 rows
Threshold Bit Score: 701.316
Threshold Setting Gi: 160914757
Created: 21-Dec-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                ####                       ##                                           
1U8X_X        29 FSIVIAGGGSTFTPGIVLXLLDHLEEFPIRKLKLYDNDKERQDRIAGACDVFIREKAPD-IEFAATTDPEEAFTDVDFVX 107 Bacillus subtilis
Q97DP6         4 YSICIVGGGSRYTPDMLAMLCNQKERFPLRKIVLYDNESERQETVGNYAKILFKEYYPElEEVIWTTDEKEAFEDIDFAL 83  Clostridium ace...
YP_175574      4 QRLVIAGSGSTYTMGMMMSLIEEKERFPLKELVFYDIDAKRQERTAKATEILFKERYPElTSFSYTTDKKEAFKDADFVF 83  Bacillus clausi...
YP_001312046   4 FNVSLVGGGSTWTPGLLASLCKLKDRFPINRLILFDIDKERQETIANYAKVLFNERYPE-LDFRYTTKVEEAYIDVDFVI 82  Clostridium bei...
ZP_03146660    4 FNVLIVGGGSTWTPGLLKAICSRQDTFPINRLVMYDINYERQKIIGEFAKVLFNEEYPDiHFSYTTDKEEAFTEDIDFVF 83  Geobacillus sp....
ZP_03295931   16 MIITLAGGGSTFTPGIVKSIALRKEELEVEEIRLYDINEERQRKVGVLVDWILHEDLGLdIKLTVTTDKKTAFSDADFVF 95  Collinsella int...
ZP_01260057    4 QKLTIVGAGSTYTLGMMNSLIAEKDNFPLAKVVFYDIDEKRQESNALATEILLREHYPEvEEFVYTTDKSVAFADSDFFF 83  Vibrio alginoly...
ZP_02076971    4 YSVVICGGGSTYTPDMMELLCMMQNDFPLRKVILYDIYSERQEVVGKFGEVMFKEYYPD-LEFFYTTDKRKAFEDIDFAF 82  Eubacterium dol...
ZP_02091529    1 MVITIAGGGSTFTAGIVKSIALRREELEVDEIRLFDINKERQDKVAVVVDWVLHKELNTdIKLVVTTDVQQAYTDTSFVF 80  Faecalibacteriu...
ZP_03305096    1 MKVAIAGGGSTWTPGLLNSIARHKEKFPIDELILYDNNPERQKNVGEFGKILFREKYEE-LNFDYTTDPKKAFEDVDYVF 79  Anaerococcus hy...
Feature 1         ###   #                  #        #                           # #              
1U8X_X       108 AHIRVGKYAXRALDEQIPLKYGVVGQETCGPGGIAYGXRSIGGVLEILDYXEKYSP-DAWXLNYSNPAAIVAEATRRLRP 186 Bacillus subtilis
Q97DP6        84 MQIRAGRLKMREKDEKISLKHGCLGQETCGAGGFAYGLRSVPAVIDLIKSIRTYSP-KCWILNYSNPAAIVAEATKRVFP 162 Clostridium ace...
YP_175574     84 VQIRTGGLAMREQDEQISLKHGVVGQETCGPGGMAYGLRSIRDMIELVKDIRRHSP-NAWILNYTNPAAIVAEALKREFP 162 Bacillus clausi...
YP_001312046  83 MQMRTGGYKMREKDEKIPLSLGVIGQETCGAGGFAYGLRSIKDMIKTIKDIRKYSK-DAWILNYTNPAAIVAEALRREFP 161 Clostridium bei...
ZP_03146660   84 VQIRTGGYEMREKDEKIPLKLGVIGQETCGPGGFAYGMRSIRDMIQLVKDVRSKTK-EAWILNYTNPAAIVAIALQQMFP 162 Geobacillus sp....
ZP_03295931   96 AQMRVGGYAMREQDEKIPLRHGCVGQETCGCGGLAYGMRTIFPMVELIDDVEKYAKpTYWILNYSNPAAIVSEACRVMRP 175 Collinsella int...
ZP_01260057   84 IQIRTGGLAMRERDEQIPLSNSCVGQETCGAGGMAYGLRSIGDMIQLVNEIRQTCP-DAWILNYTNPAAIVAEALNREFP 162 Vibrio alginoly...
ZP_02076971   83 VQIRAGGLKQRNNDEKIPYEFDCIGQETCGPGGLAYGVRSVIQMVDLIKDIRTYSK-DSWIINYSNPAAIVAEATKRIFP 161 Eubacterium dol...
ZP_02091529   81 AQMRVGGYAMREQDEKIPLRHGCVGQETCGCGGMAYGMRTIFPMIKLIDDVEKYAKkDYWILNYSNPAAIVSEACRKLRP 160 Faecalibacteriu...
ZP_03305096   80 CQIRTGGYEMREKDEKIPLSLDLIGQETCGPGGFAYGFRSIPDMIDLINKIRKYSK-KAWILNYTNPAAIVAVALKKEFP 158 Anaerococcus hy...
Feature 1               ###                                                                      
1U8X_X       187 N-SKILNICDXPVGIEDRXAQILGLSSrKEXKVRYYGLNHFGWWTSIQDQe-GNDLXPKLKEHVSQYGYipkt------- 257 Bacillus subtilis
Q97DP6       163 NdYRIINICDMPIAIMDIYAAVLGLKR-RDLEPKYFGLNHFGWFTHILDKktGENYLPKLREILKTPVDvqte------- 234 Clostridium ace...
YP_175574    163 TdTRLLNICDMPIAIMISYAKILGLDV-WELVPEYFGLNHFGWFTKIYDKs-GTDHTERLKQLIIHNGFkped------- 233 Bacillus clausi...
YP_001312046 162 EdKRVLNICDQPVNLLRSYGRVLGKDS-KNFEPVYFGLNHFGWFTNLYDEn-GNDLVPELRKVIKERGFipvd------- 232 Clostridium bei...
ZP_03146660  163 DdKRILNICDQPENLLRSYGRLLNMNE-RDFDPVYFGLNHFGWFTHLYDPq-GNDKLPELREMILKNGFrpad------- 233 Geobacillus sp....
ZP_03295931  176 N-ARIINICDMPIAIIDLVCAALEIDK-KDVEYDYFGLNHFGWFTSIRHK--GEEVLPQLREYIKEHEIllpssylkgms 251 Collinsella int...
ZP_01260057  163 HdKRILNICDMPAAIMVSYAQLLGCEI-WDFVPEYFGLNHYGWFTKIRNKq-GEDLTDKIKNIILKEGIsavd------- 233 Vibrio alginoly...
ZP_02076971  162 SdKKIVNICDMPTSVLDAYLPLIGVKR-SQIYPRYFGLNHFGWFTGLYDKetGHDYLPDLLKYVEENYDeihemf----- 235 Eubacterium dol...
ZP_02091529  161 K-ARIINICDMPIAIIDVVAAAMGIQNkKEIVYDYFGLNHFGWFTSIQYH--GEDLMPKLRAYIKENKIllpesylkgmg 237 Faecalibacteriu...
ZP_03305096  159 DdQRILNICDQPVNLLKSYGKILDMDY-HEFEPYYFGLNHYGWFTKILDKn-GKDLLPKLKEIITENGFlpad------- 229 Anaerococcus hy...
Feature 1                                                                                #       
1U8X_X       258 --------------eaeaVEASWNDTFAKARDVqaADPDTLPNTYLQYYLFPDDXVKKSNPnHTRANEVXEGREAFIFSQ 323 Bacillus subtilis
Q97DP6       235 ---------------plfQEKSWKSTFEFMSQMinDYDEYLPNTYLQYYLYPAKMRNKENPeYTRANEVMDGNEKETYER 299 Clostridium ace...
YP_175574    234 --------------keiaNDKSWQETFAMARQMliDFPEFLPNTYLQYYLYPDKMAAKENPnRTRARQVIEGRQKRIHDL 299 Bacillus clausi...
YP_001312046 233 ---------------aeqRDKSWLDTYAMVQDMvnDFPEYLPNTYLQYYYYPDYKVSHLNPdYTRANEVMDGREKRVFEE 297 Clostridium bei...
ZP_03146660  234 ---------------yeqRDKSWLETYAMVQQMvrDFPDYLPNTYLQYYLYPDKVLKKLNPdFTRANEVQAGREKRVFED 298 Geobacillus sp....
ZP_03295931  252 slmksntdnedeskqnrhTKGSWYYVWKGVYEImeLFPEYLPNTYLNYYLQQKEFVEHSNPeRTRANEVEETREHNLFAG 331 Collinsella int...
ZP_01260057  234 --------------aeiaDDPSWQATFKNMRTMlaDNPEFLPNTYLQYYLYPEKMVAKEDInNTRARQVINGREKRVFEL 299 Vibrio alginoly...
ZP_02076971  236 ------------kkkikdKNDHWAITFLDHLEMlhDFPYSLPNTYNLYYLYPDRTLKHYNIhHTRYDEVMNGREVMVFDY 303 Eubacterium dol...
ZP_02091529  238 -------altssssqnrhTKGSWYYVWKGEYEImeNFPEYLPNTYLNYYLQAKEFVEHSDPnHTRANEVEETREKNLFDG 310 Faecalibacteriu...
ZP_03305096  230 ---------------aeqRDQSWLDTYGMVEKMvnDFGDYLPNTYLQYYLYPNYKLSKLDKnYTRANEVIDGREKKVFGE 294 Anaerococcus hy...
Feature 1                                                                                        
1U8X_X       324 CDXITREQSSen-----------------------seIKIDDHASYIVDLARAIAYNTGERXLLIVENNGAIANFDPTAX 380 Bacillus subtilis
Q97DP6       300 MHKIISLGKIhgtk-------------------yeltSDVGCHAEYIVDLATAIANNTNEIFLIITENKGTINNVSKDMM 360 Clostridium ace...
YP_175574    300 CDEIIQNGTAag-----------------------adLHVDIHGVFMIKAAESLAYNLSKRFIVMVENRGIISNLPADAM 356 Bacillus clausi...
YP_001312046 298 CRRVAKAGTVegs----------------------vmVHNDAHSEFMIEVAESIAYNLKKIYIVIVKNNGIISNLDDDVM 355 Clostridium bei...
ZP_03146660  299 CMRVAETGTAkds----------------------nvVANDAHGEFILIVAESIAYNKGDNFIVILKNDGIISNLPDDAM 356 Geobacillus sp....
ZP_03295931  332 IDRYEATGEIde-----------------------stFYAGSHGDWIADLAVALKNDTKARFLVICQNRGAIPNMPYDAM 388 Collinsella int...
ZP_01260057  300 NARIIEAGTTkh-----------------------etLHADIHGRYMVRVAASLAYNLSDVYLVIVPNNGAITNLQNDAM 356 Vibrio alginoly...
ZP_02076971  304 CRKIAELGRMkgtefdisskinpdytvdnpqasstvyADNDVHASYLVELVLSIINNANEIALVMIKNDGICQNLDSEMM 383 Eubacterium dol...
ZP_02091529  311 IDHYLKTGEVda-----------------------ntFYAGSHGDWIADLSAALKNDTKARFLIITENRGAIPNMPYDAM 367 Faecalibacteriu...
ZP_03305096  295 CKKVIENNSLega----------------------nvVYNDAHGDTIVEIAMSIEYNLNNYFIVIVENNGIIKNLSDDAM 352 Anaerococcus hy...
Feature 1                                                                                        
1U8X_X       381 VEVPCIVGSNGPEPITVGTIPQFQKGLXEQQVSVEKLTVEAWAEKSFQKLWQALILSKTVPNARVARLILEDLVEANKDF 460 Bacillus subtilis
Q97DP6       361 VEVPCRVGSNGVEPLVVGSIPAFYKGLMENQYAYEKLSVDACLEGSYQKALQALVLNRTVVNTDVAKELLKDLIEANKGY 440 Clostridium ace...
YP_175574    357 VEVPALLTSNGAQPFVVGAIPTFYKGLLESQFAYEKLVVDAYFEKSYQKLLQALTLNRTVINVSTAKAVLDDLIAANKEY 436 Bacillus clausi...
YP_001312046 356 VEVASIMTANGPRPLSVGKIPTFYKGLIESQSAYEKLTVDAYFEGSYEKALQALTMNRTIVSAKKARAVLDKLIEANKEY 435 Clostridium bei...
ZP_03146660  357 VEVAASITSNGPRPYAVGEIPTFYKGLIEGQYAYEKLTVEAYMEGSYAKALQALTLNRTVVSAAKAREVLDALIEANKEY 436 Geobacillus sp....
ZP_03295931  389 VELPAYIGKNGPEVISRDNIPLFQQGLMMQQLNSEKLVVQACIEGSYEKALQAFTLNKTVPSMTVAKEVLDEMIEANKDF 468 Collinsella int...
ZP_01260057  357 VEVPAALTSDGPKAFTVGKIPTFQKAMIESQLGYEKLVVDAWYEGSQQKLINALTLNRTVVNVPKAKEITKQLLEENKAY 436 Vibrio alginoly...
ZP_02076971  384 LEVSCRIGKEEIVPLHYGSVPAFEKGLLENQYACEKLLVDAILEKDALKLRQAFTENRIVRDGDLAKKLISRFIEVNKDL 463 Eubacterium dol...
ZP_02091529  368 VELPAYIGKNGPEVIARDNIPLFQQGLMMQQLNSEKLLVEGCVEGSYEKVLQAFTLNKTVPSMSVAKAILDDMIEANKGY 447 Faecalibacteriu...
ZP_03305096  353 VEVTATLGKNGPRPFAVGEIPTFYKGMIESQYAYEKLTTEAYYEKSYSKALMALTLNRMIVDVDKAREVLDALKEANKDY 432 Anaerococcus hy...
Feature 1             
1U8X_X       461 WPELD 465 Bacillus subtilis
Q97DP6       441 WNELH 445 Clostridium acetobutylicum
YP_175574    437 WPDLK 441 Bacillus clausii KSM-K16
YP_001312046 436 WPEFK 440 Clostridium beijerinckii NCIMB 8052
ZP_03146660  437 WPELR 441 Geobacillus sp. G11MC16
ZP_03295931  469 WPELK 473 Collinsella intestinalis DSM 13280
ZP_01260057  437 LPQFF 441 Vibrio alginolyticus 12G01
ZP_02076971  464 WPTFK 468 Eubacterium dolichum DSM 3991
ZP_02091529  448 WPELH 452 Faecalibacterium prausnitzii M21/2
ZP_03305096  433 WTELK 437 Anaerococcus hydrogenalis DSM 7454

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap