1S6Y,1UP7,1UP4


Conserved Protein Domain Family
GH4_P_beta_glucosidase

?
cd05296: GH4_P_beta_glucosidase 
Click on image for an interactive view with Cn3D
Glycoside Hydrolases Family 4; Phospho-beta-glucosidase.
Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Statistics
?
PSSM-Id: 133432
View PSSM: cd05296
Aligned: 44 rows
Threshold Bit Score: 504.372
Threshold Setting Gi: 163840447
Created: 6-Dec-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 16 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Structure:1UP7_A: Thermotoga maritima 6-Phospho-Beta Glucosidase binds NAD, contacts determined at 3.5A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                ## #                       ##         #                                 
1S6Y_A         8 LKIATIGGGSSYTPELVEGLIKRYHELPVGELWLVDIPe----gKEKLEIVGALAKRXVEKAgv-----piEIHLTLDRR 78  Geobacillus ste...
1UP7_A         3 MRIAVIGGGSSYTPELVKGLLDISEDVRIDEVIFYDID------EEKQKIVVDFVKRLVKDRf--------KVLISDTFE 68  Thermotoga mari...
NP_822930      1 MKLTILGGGGFRVPLVYGALLGDRAEGRVTRVVLHDLD------AGRLTAVARVLAEQAAGDpd-----apEVSFTTDLD 69  Streptomyces av...
YP_001221088   1 MRLTILGGGGFRVPLVYSALLRDHEAGRVDHVALYDTD------EVRLTAVARVLAEQAAAYad-----apVITLHTDLD 69  Clavibacter mic...
CAC49689       1 MKLTLIGGGGVRAPLFVGSALRRAERSGLSEICLQDIN------ERKLELFGRISQELARRTqs-----pvRITMAADAE 69  Sinorhizobium m...
ZP_02043548    4 MQLTIVGGGGFRVPAMIDVLARSRSGQGAYASLDVDRVilydtdARRLDAMMAVLSSLDFPHs-------pTVRATTDIN 76  Actinomyces odo...
YP_948598      1 MRLMIAGGGGFRVPLVYRALCAGPFAGLVDELVLFDVD------GSRLAAMEAVLRDMPADEgs-----apAVVVSTDLG 69  Arthrobacter au...
AAT81821       1 MKLTILGGGGFRVPLVFKALAHDTSPQRVTELRLYDTD------PLRLGVIETVVAQLARALph-----apSVVATTDLP 69  Propionibacteri...
YP_290824      1 MRLTILGGGGFRVPLIHRALLADARHPDPPITELVLFDt----aPERVAVIRTILEQQREAHravygepplTVRVADTLD 76  Thermobifida fu...
YP_001624852   1 MRLVIIGGGGFRVPLVYRALSAGKYAGLIDSVALYDVD------ASRLAAIQAVLAAAPFSGp--------VVMASTSLP 66  Renibacterium s...
Feature 1                   ###                      #                   #               # #     
1S6Y_A        79 RALDGADFVTTQFRVGGLEARAKDERIPLKYGVIGQETNGPGGLFKGLRTIPVILDIIRDXEELCpDAWLINFTNPAGXV 158 Geobacillus ste...
1UP7_A        69 GAVVDAKYVIFQFRPGGLKGRENDEGIPLKYGLIGQETTGVGGFSAALRAFPIVEEYVDTVRKTS-NATIVNFTNPSGHI 147 Thermotoga mari...
NP_822930     70 EALRGADFVFSAIRVGGLEGRADDERVALAEGVLGQETVGAGGIAYGLRTVPVAVDIARRVARLApDAWVINFTNPAGLV 149 Streptomyces av...
YP_001221088  70 EALAGAAFVFSAIRVGGMAGRSCDERLGMAHGVIGQETVGYGGISYALRTLPVVMDLAERIRVQApDAWVINFTNPAGVV 149 Clavibacter mic...
CAC49689      70 RALDGARYVVTTVRPGNEDGRIKDERIALAHGVLGQETTGPGGFAMALRSIPVILKYAEILKKVSpDAWLFNFTNPAGLV 149 Sinorhizobium m...
ZP_02043548   77 EALPGADFVFSAMRVGGTCGRVLDEHCGLDHGLLGQETVGVGGYCYAFRSLGPALELARAAKRLCpGAWLINFTNPAGII 156 Actinomyces odo...
YP_948598     70 QALTGTDMVFAAIRPGGTAGRITDEQIPLGLGLLGQETTGAGGISYALRSIPHMLELAAAMRRHCpDAWLINFTNPAGMV 149 Arthrobacter au...
AAT81821      70 TALAGTDFIFSAIRVAGTHGRALDESMCLARGVIGQETVGAGGISYALRGIPVVLDLVEQITRYApDAKVINFTNPAGVM 149 Propionibacteri...
YP_290824     77 EALRGSAIVFSAVRVGGAEGRVRDERVALAAGVLGQETVGAGGISYGLRTVPVAVAIAQHVARLApQAWVINFTNPAGLI 156 Thermobifida fu...
YP_001624852  67 QALEGADIVFSATRVGGPEGRVLDERVALDLGVLGQETTGAGGISYAFRSIPFMVQLAQERRNHCpAAWLINFTNPAGMV 146 Renibacterium s...
Feature 1                                                                                        
1S6Y_A       159 TEAVLRYtkQEKVVGLCNVPIGXRXGVAKLLgv-------------daDRVHIDFAGLNHXVFGLHVYLDGVEVTEKVID 225 Geobacillus ste...
1UP7_A       148 TEFVRNYleYEKFIGLCNVPINFIREIAEMFsa-------------rlEDVFLKYYGLNHLSFIEKVFVKGEDVTEKVFE 214 Thermotoga mari...
NP_822930    150 TEAMSRHl-GDRVIGICDSPVGLGRRIARVLga-------------dpREAFIDYVGLNHLGWVRGLRVAGRDELPRLLA 215 Streptomyces av...
YP_001221088 150 TEAMSRVl-GDRVIGICDSPIGLARRVLGALgv-------------qgDDVVIDYAGLNHLGWLRGLRVDGRDVLPDLMA 215 Clavibacter mic...
CAC49689     150 TQALQNEg-YHRTVGICDGANGAQEALAHWHkv-------------qqNDVRCEVYGLNHLSFTRRATIDGKEVLQPLLD 215 Sinorhizobium m...
ZP_02043548  157 TQAMRSVl-GERVVGICDTPIGLVNRTLNALgvad----------eerTDVSFDYVGLNHLGWLRSLSVDGRDILPRLFA 225 Actinomyces odo...
YP_948598    150 TEALVPIl-GRRVIGICDSAGGLVQRAARAAgapl----------negTLDGVGYYGLNHLGWLYRLAPAGRDLLPGLLS 218 Arthrobacter au...
AAT81821     150 TEVMQRRl-GDQVVGICDSPVGLARRILTTLqraglapadlgslfdgdGRIHIGYSGLNHLGWLTSLNVDGVDVLPRLLE 228 Propionibacteri...
YP_290824    157 TEAMTQIl-GDRIIGICDSPVGLGRRAARALgl-------------dpARVHFDYAGLNHLGWLRGLHADGRNRLPDLLA 222 Thermobifida fu...
YP_001624852 147 TQALVPLl-GAKVIGICDSPLGLVRRAAKTAgip------------lsGMNGVDYLGLNHLGWLNGLVHDGVDQLPGLLS 213 Renibacterium s...
Feature 1                                                                           #            
1S6Y_A       226 LVAHPDrsgvtxknivdlgWEPDFLKGLKVLPCPYHRYYFQTDKXLAEELEAakt-kgTRAEVVQQLEKELFELYKDpnl 304 Geobacillus ste...
1UP7_A       215 NLKLKLsnip------dedFPTWFYDSVRLIVNPYLRYYLMEKKMFKKISTHe-----LRAREVMKIEKELFEKYRTav- 282 Thermotoga mari...
NP_822930    216 DPGLLGsfee------gklFGPDWLRSLGAIPNEYLHYYYFNREAVRAYSEAe----kTRGAFLRDQQARFYEEMKRads 285 Streptomyces av...
YP_001221088 216 RPDLIGtfee------grlFGAEWVTELGAVPNEYLHYYYFRREVRHADQLAa----qTRGAFLVEQQGRFYEQLEHrhd 285 Clavibacter mic...
CAC49689     216 DDGFLRsts-------qrmFDASLIRSQRNWINEYLYYYYYAEKAVEALKADa----rTRGEEVKDLNAALITRLSAmdl 284 Sinorhizobium m...
ZP_02043548  226 DEAALGsmee------sraIGTDWIRALGALPNEYLFYYYCHREAMARIHQDq-----TRGEYLRDQQEAFYNAVLAdpe 294 Actinomyces odo...
YP_948598    219 DRVALEtmee------grlFGQHTLEKLGCLPNEYLYYYYQTAQATEAIGQQs----eTRGTSIHQQQNSLYPSLLQdph 288 Arthrobacter au...
AAT81821     229 RPDLIEsfee------grlFGADLVQALGAVPNEYLHYYYYSRDDLAADRKAe----aPRGAFLEAQQNQFYTQAQHtdd 298 Propionibacteri...
YP_290824    223 DEAALTsfee------grlFGAAWLRALGALPNEYLHYYYLARETREEIARTlaagghTRGEQLVVQQKEFYRLAAArpr 296 Thermobifida fu...
YP_001624852 214 SPARLAefee------grlFGADFLAALVSLPNEYLFYYYRRQSALQAIMAAa----qTRGASIALAQQMSYPQFTGaka 283 Renibacterium s...
Feature 1                       #                                      #                         
1S6Y_A       305 ------aikPPQLEKR----------------------------------GGAYYSDAACSLISSIYN----------DK 334 Geobacillus ste...
1UP7_A       283 -------eiPEELTKR----------------------------------GGSMYSTAAAHLIRDLET----------DE 311 Thermotoga mari...
NP_822930    286 sa---lsawDRTRAEReatymaenrda-------------agagerdaddLSGGYEKVALALMRAIAR----------DE 339 Streptomyces av...
YP_001221088 286 vs--alalwERTRLDRettymatnrqs------------agmgdrdeddlVSGGYEDVAIALMRGIAY----------DQ 341 Clavibacter mic...
CAC49689     285 nadaerrspPNYAYERrrnatymhyaltdapsmeeadrlveglaaaqtgeEGEGYAGVALNLVDALET----------GK 354 Sinorhizobium m...
ZP_02043548  295 qa---gqtwIDALADReatymaeardv------------dersgrraediAGGGYQKVALDLMKALATnt------paRM 353 Actinomyces odo...
YP_948598    289 p----yrlwDAARRSReegylaeart--------------hgeqrdesdlAGGGYERVALSVMRALSGggtaqlilnvPN 350 Arthrobacter au...
AAT81821     299 v----aglwEATRLEReetymatnrev------------sgeferdeadlETGGYDKVALAIMHAIAN----------DV 352 Propionibacteri...
YP_290824    297 da---ydlwEQTRREReetymadnrra------------aggverdeadlDGGGYEQVALAVMRAILR----------DE 351 Thermobifida fu...
YP_001624852 284 f-----erwDAARLEReagylaesr----------------dsardeadlAGGGYDEVALAAMNTLLT----------GQ 332 Renibacterium s...
Feature 1                                                                                        
1S6Y_A       335 RDIQPVNTRNNGAIASISAESAVEVNCVITKDGPKPIAVGD-LPVAVRGLVQQIKSFERVAAEAAVTGDYQTALVAXTIN 413 Geobacillus ste...
1UP7_A       312 GKIHIVNTRNNGSIENLPDDYVLEIPCYVRSGRVHTLSQGK-GDHFALSFIHAVKMYERLTIEAYLKRSKKLALKALLSH 390 Thermotoga mari...
NP_822930    340 RTTLILNVRNRGALTVLDAEAVIEVPCLVDANGAHPVAVDP-LPGHATGLVCAVKAVEREVLSAAESGSRATAVKAFALH 418 Streptomyces av...
YP_001221088 342 SARLILNVRNRGTLAALDADAVVEVPCVVDASGAHPVAGTE-LPDFGVGLVTNAKYVERQTIEAGLGGSRAAAVRALAHH 420 Clavibacter mic...
CAC49689     355 PCYTGLNVRNEGAIEGLRNDDVVEVSCLVDGEGIRPLKIGA-MPEAQSQIVHNVKRYERLAVRAIRERSRDLAVQALMAH 433 Sinorhizobium m...
ZP_02043548  354 ILNVGNGDGGFSSIPTLRDADVVEVPCDVDASGVHPIPVAP-LEGAALGLVQSVKACENLVIDAAREHDRSLAWQALALH 432 Actinomyces odo...
YP_948598    351 SPVSAPAPAAEVAVPGLPADAVVEVPCQVTPDGALPLPQER-PDGPFLTLMQHVKEVERLTIRAVVAGDREAAVQAFAAH 429 Arthrobacter au...
AAT81821     353 PAELILNVANHGALPDLPDEAVVEVPCRVDGAGIHRLPTPA-LPDHARGLVVNAKYVEQRTIDAAVNHSRTAALLALSHH 431 Propionibacteri...
YP_290824    352 PARLIVNVRNRGALPGVDADAVVEVPCLVDASGARPLAVDP-LAPHQLALVHAVKAVEREVLHAVRTGSRTAALRAFATH 430 Thermobifida fu...
YP_001624852 333 SVELILNVRNGRTLPALASDAVIEVPSRVDSSGATPLPLLSsPTAHQLGLMAQLKAVENAVVRAVLERNREQALLAFALH 412 Renibacterium s...
Feature 1                                
1S6Y_A       414 PLVPSDTIAKQILDEXLEAHKEYL 437 Geobacillus stearothermophilus
1UP7_A       391 PLGPDVEDAKDLLEEILEANREYV 414 Thermotoga maritima
NP_822930    419 PLVDSVNVARRLVDGYTSVHPGLT 442 Streptomyces avermitilis MA-4680
YP_001221088 421 PLVDSVTVARSLLEDAMHAFPALS 444 Clavibacter michiganensis subsp. michiganensis NCPPB 382
CAC49689     434 PLVLSYSRAVPLVDEYLAAHAEFA 457 Sinorhizobium meliloti 1021
ZP_02043548  433 PLVDSVNVARDVLDQAIRTNPLVA 456 Actinomyces odontolyticus ATCC 17982
YP_948598    430 PLVGSVPLGRQLLEGYEAAFPELS 453 Arthrobacter aurescens TC1
AAT81821     432 PLVDSVHVAEQLLDDFADAFDGLE 455 Propionibacterium acnes KPA171202
YP_290824    431 PLVDSVAVAQRLLDGYLQAFPELA 454 Thermobifida fusca YX
YP_001624852 413 PLIGDEVLAHRLLEGYEQAFPALP 436 Renibacterium salmoninarum ATCC 33209

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap