Conserved Protein Domain Family
MDH_like

?
cd05295: MDH_like 
Malate dehydrogenase-like
These MDH-like proteins are related to other groups in the MDH family but do not have conserved substrate and cofactor binding residues. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subgroup are uncharacterized MDH-like proteins from animals. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Statistics
?
PSSM-Id: 133431
View PSSM: cd05295
Aligned: 8 rows
Threshold Bit Score: 724.167
Threshold Setting Gi: 196013416
Created: 22-Dec-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:putative NAD binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
AAH88356       9 RADCPYYAKTELVADYLQKNLPDFRIHKITQRPEVWEDWLKDVCEKNKWSHKNSPIIWRELLDRGGKGLLLGGYNEFLEH 88  human
AAM18871       9 QADCPYYAKVELLADSLQSKLQDFHVHKIVKTPEEWKPWLQQLCADNGWTHGRSPIIWRELVDRGGKGLLIGGHNDFMEY 88  Florida lancelet
XP_421952      9 RAGCPEYARAELLADYLQANLPAFRVHKVVQHPDRWEQWLHDVCEMNGWEHEWSPIIWRELLDRGGKGLLLGGLNEFLEY 88  chicken
XP_001370528 143 KADCPYFAKAELLADYLQKNLPDFQIHKIIQHPDIWEQWLQDICKKNQWSHKRSPIIWRELLDRGGKGILLGGFNEFMEH 222 gray short-tail...
EDO45840       9 RSDCPFYAKAELLADELSLNLPDFKVHKIVKRPDEWDDWMNKMCDDNGWKHSGSPLIWRELVDRGGKGILLGGCDDFLEF 88  Nematostella ve...
XP_001508036   1 RADCPFFAKAEILADYLQKNLPNFRIHKIKQHPDLWERWLKDLCTKNRWSHKLSPIIWRELLDRGGKGQLLGGLNEFLEY 80  platypus
XP_002116569   9 RSNCPFYAKAELLADELAMNLPNFKVHKISKHPSEWEAWLRQTCLGMGFEHDTSPIVWRELVERGGAGKLIGDCNDFLEY 88  Trichoplax adha...
XP_793712      3 RANCPYYAKVELLADELDATLQDFSVHKIVKQPAEWEDWLQQQCKQNNWSFKKSPIVWRELLDRGGAGVLIGGSNEFQEY 82  Strongylocentro...
Feature 1                                                         # ####                         
AAH88356      89 AQLYYDVTSSMTTELMmvIAQENLGAHIekEQEEEALKTCINPLQVWITSASAPACYNLIPILTSGEVFGMhTEISITLF 168 human
AAM18871      89 ARSYYGMTSGMLSEMMknIAAENLAVTQelREEEETIRRQSKPLHVCVINAARSPAYHVLPSLVNGKILRE-EEIALHLH 167 Florida lancelet
XP_421952     89 AQHYYGITSMMLTEEMldIAEENLQAHVesEKEQEEIRSLINPLQIWITSASAPTCYQLIPLLASGDVFGMtTEISIHLL 168 chicken
XP_001370528 223 IELYYGITSKMMTDDMllIADENMETHIeiEQEEKELKEMINPLQVWITGASCPTCYHLIPILASGEVFGLeEEISINLL 302 gray short-tail...
EDO45840      89 AEGYYGLASRLKSAKLvsISEENKSTKIevDKEEEELAKKINPLRVCVSKASGPLAYGMLASLVQGEVFGFqEEVSIYLL 168 Nematostella ve...
XP_001508036  81 SQLYYGISSDMTSEEMqlIAEENLQSHIevELEREERESLINPLQVWICRASALACYILIPILASGEVFGMeTEISIHLL 160 platypus
XP_002116569  89 VESYYHFSSSMMSEELtvVADENMETLA--KDLAEAKIVKSWPLRVCITNASSSLVYNIVLSLANGDAFGKnEELDLRLV 166 Trichoplax adha...
XP_793712     83 AYSYYGVSSEQMSSDMtkIASENLETKIimDAEEQHRLSRSTPLQVCITNSSSPIAYHMVNEIARGDVLGHdNEVSIRLL 162 Strongylocentro...
Feature 1        ##                                           ###                                
AAH88356     169 DNKQAEEHLKSLVVETQDLASPVLRSVSICTKVEEAFRQAHVIVVLDDSTNKEVF---TLEDCLRSRVPLCRLYGYLIEK 245 human
AAM18871     168 DSEENLEKLKGLEMEVFDLSFPFLKEISVTTDLPTAFQNAHIAIVLDDFDQGGKE---DAIGDMETKVSFYKRVAEAINQ 244 Florida lancelet
XP_421952    169 DAVQFKECLSGIVMEAEDMAFPLLRSISAHTEVDKAFLQADVIIVLDDILLKRGTl--TLENCIRTVSEICQVYAPLIEK 246 chicken
XP_001370528 303 SSTYNEDNLRGLVMESEDLALPLLRNISLCTEINEAFLEAHVIVILNDIIEDESE---PLEDRIRDRFPICQLYGSLIDK 379 gray short-tail...
EDO45840     169 DTPENQEALQGVAYEIEDCAWPLFRGVHITSDPAVAFKDASVVVLLDGKAINEGT---DKKEYLLSHAKLFRDYGKALEA 245 Nematostella ve...
XP_001508036 161 DSHRYRRILEGLVIAAQDLAAPLLRNISKHTDFERAFFEADVIVLLDDTLEKEVL---SLEHCLRGEMMKCRRYGSLIEK 237 platypus
XP_002116569 167 DSGENLEKLHGLVMELEDLAGPLLRKITATGQLDVGVKDAQVVILTDGSSIPIDAsdeDKQTIINANRAIYQDYGPVIEE 246 Trichoplax adha...
XP_793712    163 TKPEDKDYVEGQCMEVFDLACPLLRGVKVYTDATAALTGVHVAVFLDEFCLMEEEn-aKLGGVSQEGCAQFALYGRILNQ 241 Strongylocentro...
Feature 1                  # ##                        #                               #         
AAH88356     246 NAHeSVRVIVGGRTFVNLKTVLLMRYAPRI--AHNIIAVALGVEGEAKAILARKLKTAPSYIKDVIIWGNISGNNYVDLR 323 human
AAM18871     245 TASkDIRVLVAGTGPLNSLVSILIDHTPSIp-RQNIAAVAQVKERQAKSLLAKRLTVNSAGVCDVIVWGNVGGTTYTDVS 323 Florida lancelet
XP_421952    247 NAKsGVRIISTGKTFVNLKAMMIITYGPSIk-PENVIAVATSWESAAKAMLARKLNMNTAGVKDVIVWGNVTGCTYIDLS 325 chicken
XP_001370528 380 NANeNVKVIVAGKTFLNLTTSLIIQHTPSVn-PRNIIAVAMIVENEAKAMLARKLKTLPSYVKDVIIWGNITGFRYIDLK 458 gray short-tail...
EDO45840     246 HAK-PDCKVLTAGGPANFSTFIASKFAPSIq-KKNFVSLSRIEENRAKGLIAKRLNVNTAGIKDLIVWGNPGFNHYPDAS 323 Nematostella ve...
XP_001508036 238 NANrEVKVIVAGRTFVNLKTLSIVKYAPSIr-QENVIAVAMLLENKAKALLARKLRIASSGIKDVIVWGNITGSNYIDLR 316 platypus
XP_002116569 247 GID-KDGIIFIGGEAANYQASVLSKYAPKVpkRKFIALSSRLQENRAKSVLSNRLKVNSSKINNVIVWGNPQINQVIDVS 325 Trichoplax adha...
XP_793712    242 YAEqDVKVLIGGRGKLNFSALMLKHNAPRIa-RQNIIITPRLQENRAKAAIARKINVNTAGVADLIIWGNIGGITHFDIS 320 Strongylocentro...
Feature 1                                                                                        
AAH88356     324 KTRVYRYESAIWGPLHYSR--PVLNLIFDSEWVKREFVAILKNLtt----tgRQFGGILAAHSIATTLKYWYHGSPPgEI 397 human
AAM18871     324 RARVHGYDGAIWGPPSYSC--SVSEMVHDNKWLEGEFLEQLQSRshtiqdslQHSADLSMAAAISSTLSYWWNGSPEgQL 401 Florida lancelet
XP_421952    326 HAKLYRCDSAIWGPANFSR--PLLNLIYDSKWINSEFISAQSSLrs----rvCHCAGMLPAHAVATALRYWFHGSPPgEI 399 chicken
XP_001370528 459 KAKIFKYNSAIWGPPNYSR--FLLQLIFDSEWIRKEFVASLNAWsl----keHFQKAIPSAHCIATMLTFWFHDSPPgEF 532 gray short-tail...
EDO45840     324 HARVDGFDGAIWGPHVPGFtrPVPEMVHDNKWLSGEFVEVLKKPs-------EGENALMGSVAVKSLLQDWCQCASS-DM 395 Nematostella ve...
XP_001508036 317 KAKLYRYDSAIWGPPNYSR--PLLGMIYDSEWINKEFIAELNVLns----sqNRSQAISPAHSIATTLKYWYQDSPPgEI 390 platypus
XP_002116569 326 KSHVYDCDSAIMGPADYSR--SVVELVHDNKWINGTFQATVKDRheeitklrPGETSISIANSIIEQLSDFWHGKNDdII 403 Trichoplax adha...
XP_793712    321 QARVYKYEGAIWGPSSFSR--PVTEVVHDEKWLQTEYPQLLQNHpdalatmlNHKVAMSEAHALTSILTHWYNGSPDkEI 398 Strongylocentro...
Feature 1                                                                       
AAH88356     398 VSLGILSEGQFGIPKGIVFSMPVKFENGT-WVVLTDLKDVEISEQIMTRMTSDLIQEKLVALG 459 human
AAM18871     402 FSLAVCSEGFYNIPEGVVFSFPVMFHKGS-WEVVQDIDMNEDMRVMLSSITAQLVEEKDLLLH 463 Florida lancelet
XP_421952    400 VSMGVLSEGQFCIPEGIIFSMPVRFQNGS-WEVVTELEINEKTQEVLECLSYDLIQEKRVALK 461 chicken
XP_001370528 533 FSVGIRSEGEFGMPEGMVISMPAQCQNGI-WTVPTDLIESELTEDVRNRIIHDLQQEQLVASG 594 gray short-tailed opossum
EDO45840     396 WSLGVISEGWYDIPEGIAFSFPVKFTGGS-WQVVEGLALSDSLKEVLKNIAQEAKAETEEVLA 457 Nematostella vectensis
XP_001508036 391 VSLGVMSDGQFGVPEGIVFSMPVKFQNGK-WVVLTDLEDVEINEETMKVLVSDLIQEKLVAFG 452 platypus
XP_002116569 404 TSMSIISEGWYGIPYGIAFSFPVQLKARGeLQVVTDWGLDETLRGKLVAIGRELFKVLNASSE 466 Trichoplax adhaerens
XP_793712    399 FSLGVYSDGWYDLPVDIFFSLPVKFQKGA-WEVVQDRQVTTEIRAQLDQITNELIHERYVIFP 460 Strongylocentrotus purpuratus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap