1HYE


Conserved Protein Domain Family
LDH-like_MDH_nadp

?
cd05294: LDH-like_MDH_nadp 
Click on image for an interactive view with Cn3D
A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity
The LDH-like MDH proteins have a lactate dehyhydrogenase-like (LDH-like) structure and malate dehydrogenase (MDH) enzymatic activity. This subgroup is composed of some archaeal LDH-like MDHs that prefer NADP(H) rather than NAD(H) as a cofactor. One member, MJ0490 from Methanococcus jannaschii, has been observed to form dimers and tetramers during crystalization, although it is believed to exist primarilly as a tetramer in solution. In addition to its MDH activity, MJ0490 also possesses fructose-1,6-bisphosphate-activated LDH activity. Members of this subgroup have a higher sequence similarity to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)- binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenase, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Statistics
?
PSSM-Id: 133430
View PSSM: cd05294
Aligned: 6 rows
Threshold Bit Score: 504.631
Threshold Setting Gi: 51316149
Created: 16-Dec-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:NADP binding site [chemical binding site]
Evidence:
  • Structure:1HYE_A; Methanocaldococcus jannaschii Mj0490 contacts to NADP at 3.5A
    View structure with Cn3D
  • Comment:The Methanocaldococcus jannaschii Mj0490 prefers NADP(H) as a cofactor, unlike related LDH-like MDH family members which prefer NAD(H).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              # # ##                     #                                              
1HYE_A         1 MKVTIIGASGRVGSATALLLAKEPFMKDLVLIGREHSINKLEGLREDIYDALAGTRSDANIYVESDenLRIIDESDVVII 80  Methanocaldococ...
O26290         1 MKVSIIGSTGRVGRATALCLAEEEAVKTLHLISRKESLEQNLGEVLDMSDALAAKGVSVKLENSAD--IENVYGSRIVVI 78  Methanothermoba...
Q8TWG5         2 SKVAVIGATGRVGSTAAARLALLDCVNEVTLIARPKSVDKLRGLRRDILDSLAAAQKDAEITIGCE--RDDYVDADVIVM 79  Methanopyrus ka...
Q2NGI3         2 VKITIMGASGTIGKTVAFNLAEKDVIDEIIMFSRPASHERVKGEILDMYDALAAEDIDCELKASSD--YADLAGSSIVLI 79  Methanosphaera ...
Q6LZI3         1 MDVSIIGASGKIGSVLSLLLAKESHIKNINLIARSSSINKLKGLKMDLYDAMAAAGQDTDIDICCDddLSCTANSDITII 80  Methanococcus m...
YP_001324807   1 MEISIIGASGKIGTAISVLLAKEKYVRHINLISREKSLDKLKGLKLDIYDAIAAEELDVEISVHDEkdLSVVCNSKITII 80  Methanococcus a...
Feature 1        #  # #                   #               ###                                    
1HYE_A        81 TSGVPRKEGMSRMDLAKTNAKIVGKYAKKIAEI-CDTKIFVITNPVDVMTYKALVDSKFERNQVFGLGTHLDSLRFKVAI 159 Methanocaldococ...
O26290        79 TAGVPRTADMDRDDLAFKNGRIVADYARQIARFaPDSIILVVTNPVDVMTYVALRYSGFHPSRVFGLGNHLDSLRLKNYM 158 Methanothermoba...
Q8TWG5        80 TAGIPRKPGQTRLDLTKDNAAIIKKYLEGVAEEnPEAIVLVVTNPVDVLTYVALKVSGLPKNRVIGLGTHLDSMRFKVLI 159 Methanopyrus ka...
Q2NGI3        80 TSGVPRKEGMSRLDLAVPNSKIVQEYSKQIAIHaPDSVILIVTNPVDVMTSIALKTSGFDKKRVIGLGNHLDSLRLKTLL 159 Methanosphaera ...
Q6LZI3        81 TAGMARTGEMSRIDLMKGNAKIVKNYVKNIANF-GDTKIFMISNPVDLMTYKALIESGYEKNQVFGLGTHLDSMRFKVAV 159 Methanococcus m...
YP_001324807  81 PAGAPRTGDMTRLDLAKKNAGIVKRYAKDIGKT-CDTKLFMITNPVDVMTHKALIESGYDKSQVFGLGTHLDSMRFKVAI 159 Methanococcus a...
Feature 1                                                                         #              
1HYE_A       160 AKFFGVHIDEVRTRIIGEHGDSMVPLLSATSIGGIPIQkfer------fkelPIDEIIEDVKTKGEQIIRLKGGSEFGPA 233 Methanocaldococ...
O26290       159 ARHFNVHVSEVHTRVIGQHGPYMVPLISSTSIGGIPIEhyarrdyfsgykkfDLKKTIDKVIHAGSNIISRKGATEYGPA 238 Methanothermoba...
Q8TWG5       160 AKHFNVHMSEVHTRIIGEHGDTMVPVISSTSVGGIPVTrmpg------wedfDVEEAVREVKEAGQRIIETWGGSQFGPA 233 Methanopyrus ka...
Q2NGI3       160 SKHFHINSREIHTRVIGEHGDHMVPLLSSTTIGGILLKsfve------ymdlDVPKLVETLKNSGNNIISKKGATEYGPS 233 Methanosphaera ...
Q6LZI3       160 AKHFEVHLDDVRTRIVGEHGDSMVPVISATAVGGIPIKrlpk------yedfPYEKILERIKGYGQEIINLKNGSEYGPA 233 Methanococcus m...
YP_001324807 160 AKYFNAHIGDVRTRIIGEHGDSMVPLISSTAIGGIPITrlpe------ykdfPYNEVVDFVKNGGKRIIQLKGGSEYGPA 233 Methanococcus a...
Feature 1                                                                                      
1HYE_A       234 AAILNVVRCIVNNEKRLLTLSAYVDGEFDGIR-DVCIGVPVKIGRDGIEEVVSIELDKDEIIAFRKSAEIIKKYCEEV 310 Methanocaldococcu...
O26290       239 FAISNIVTTILNDERRILTVSTLMEGEIDGIR-DVCLGVPVKLGKNGIEGVVPVLMDRDEREAFREAANHVRDSTRRV 315 Methanothermobact...
Q8TWG5       234 QAITNLVRTILQDERRVLTVSAYLDGEIDGIR-DVCIGVPARLGREGVLEIVPIELEEDEMRAFRRSVKVVKEATREA 310 Methanopyrus kand...
Q2NGI3       234 YAISNLILTIANDTRKILTVSTYLEGEVEGVY-DVSLGVPVILCKHGIKRIVPLKMNDEERTEFFDAARTVKKTTYEL 310 Methanosphaera st...
Q6LZI3       234 SAIVNIVRCIAHDEKRLLTLSTYIEDEIEGIEgGCCIGVPVKVGKNGIEEVIHIKMEDDEIEGFKKSFELVKGYCRQI 311 Methanococcus mar...
YP_001324807 234 SAVLNVVRCIANDNKKYLTLSTYLDGELDGIK-DVCIGVPVVIGKKGIERIVPIELDEKEFNDFKKSVEIVKRYWNEV 310 Methanococcus aeo...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap