2DQ4,2DFV,3GFB,2D8A


Conserved Protein Domain Family
TDH

?
cd05281: TDH 
Click on image for an interactive view with Cn3D
Threonine dehydrogenase
L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)- dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria) and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Statistics
?
PSSM-Id: 176184
View PSSM: cd05281
Aligned: 51 rows
Threshold Bit Score: 562.24
Threshold Setting Gi: 160902991
Created: 23-Aug-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 19 residues -Click on image for an interactive view with Cn3D
Feature 1:NADP binding site [chemical binding site]
Evidence:
  • Structure:2DFV: Pyrococcus horikoshii L-threonine dehydrogenase binds NAD, contacts at 4A
    View structure with Cn3D
  • Structure:3GFB: Thermococcus kodakaraensis L-threonine dehydrogenase binds NAD+, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
2DQ4_A         1 MRALAKLAPEEGLTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDAWARgRIRPPLVTGHEFSGVVEAVGpgVRRPQ 80  Thermus thermop...
2DFV_A         4 XVAIXKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQsRIKPPQIXGHEVAGEVVEIGpgVEGIE 83  Pyrococcus hori...
YP_001813529  18 MRALVKEERGFGAVLKEVAVPSPKRGEVLIRVEATSICGTDVHIYEWDAWAAsRVNPPYVFGHEFSGEVVELGegTKRLK 97  Exiguobacterium...
Q67N85         5 MRALRKLEAGPGATLQEVPIPTIGPRDVLVKVRAASICGTDYHIYTWDPWSAgRVKPPLTIGHELAGEVVAVGreVTACK 84  Symbiobacterium...
EDP83287       5 MKALVKHRSGHGAEMQMVPIPEIGPKEVLIEVKAASICGTDVHIYEWDRWAEsRVKPPYVFGHEFSGVVKEVGdlVTNVK 84  Bacillus seleni...
Q65JE7         5 MKALIKKPGEPGASFELVPIPKIDKHEVLIKVKAASICGTDVHIYNWDEWAKsRVKPPYVFGHEFSGEVVQVGenVTTVK 84  Bacillus lichen...
ACB60512      18 MRALVKEERGFGAVLKEVAVPSPKRGEVLIRVEATSICGTDVHIYEWDAWAAsRVNPPYVFGHEFSGEVVELGegTKRLK 97  Exiguobacterium...
EDW23300       5 MKAIVKKESAYGAVLMEMPIPEINDHEVLIQVKATSICGTDVHIYNWDDWAKgRVKAPYIFGHEFTGEVVKTGkqVSRAK 84  Bacillus pumilu...
ACQ69357      17 MKAIQKHTAGFGAKLVDVPVPTPGPGEVLIQVKATSICGTDVHIYEWDEWSQsRVKPPYVFGHEFSGEVVALGegTKRIK 96  Exiguobacterium...
O31776         6 MKALMKKDGAFGAVLTEVPIPEIDKHEVLIKVKAASICGTDVHIYNWDQWARqRIKTPYVFGHEFSGIVEGVGenVSSVK 85  Bacillus subtilis
Feature 1                                                                               #        
2DQ4_A        81 VGDHVSLESHIVCHACPACRTGNYHVCLNTQILGVDRDGGFAEYVVVPAENAWVNPKDLPFEVAAILEPFGNAVHTVYAG 160 Thermus thermop...
2DFV_A        84 VGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAG 163 Pyrococcus hori...
YP_001813529  98 LGDRVSAETHIVCHQCKQCLRGQYHICKNTKIIGVDTQGCFAEYVVMPEENLWVNPEDMPAAIASIQEPMGNAVHTVLAS 177 Exiguobacterium...
Q67N85        85 VGDYVSAETHIVCNRCPRCHMGEYHLCENTKILGVDTDGAFAEYVAVPEQNIWVNDKDIPFELQSIQEPLGNAVHTALNG 164 Symbiobacterium...
EDP83287      85 QGDHVSAETHIVCGHCPQCMTGKAHICQDTKIIGVDRDGCFAEYVSLPAENLWVNDPDLPFEEASIQEPFGNAVHTVLEG 164 Bacillus seleni...
Q65JE7        85 EGEYVSAETHIVCGKCLPCLTGKEHVCKKTLILGVDTDGCFAEYVKMPAANIWKNPAGMPEDLASIQEPLGNAVHTVLTG 164 Bacillus lichen...
ACB60512      98 LGDRVSAETHIVCHQCKQCLRGQYHICKNTKIIGVDTQGCFAEYVVMPEENLWVNPEDMPAAIASIQEPMGNAVHTVLAS 177 Exiguobacterium...
EDW23300      85 VGDFVSAETHVVCNQCSMCLTGQQHLCNETKILGVDIDGCFAEYVKVPEQNVWHNPAQMPVELASIQEPLGNAVHTVLHT 164 Bacillus pumilu...
ACQ69357      97 VGQAVSAETHIVCHQCKQCLRGQYHICKNTKIIGVDTQGCFAEYVVMPEENLWVNPESMPAKLASIQEPLGNAVHTVLAS 176 Exiguobacterium...
O31776        86 VGEYVSAETHIVCGECVPCLTGKSHVCTNTAIIGVDTAGCFAEYVKVPADNIWRNPADMDPSIASIQEPLGNAVHTVLES 165 Bacillus subtilis
Feature 1                   # ###                  ###   #              #                        
2DQ4_A       161 SgVSGKSVLITGAGPIGLMAAMVVRASGAGpILVSDPNPYRLAFARP-YADRLVNPLEEDLlevVRRVTGS--GVEVLLE 237 Thermus thermop...
2DFV_A       164 P-ISGKSVLITGAGPLGLLGIAVAKASGAYpVIVSEPSDFRRELAKKvGADYVINPFEEDVvkeVXDITDGn-GVDVFLE 241 Pyrococcus hori...
YP_001813529 178 D-VSAKTVAIVGCGPIGLMAVSVAKAAGAAeVIAIDVNPYRLELAKTmGADVVIDSRHEDVlerVRMMTDGd-GIDVVCE 255 Exiguobacterium...
Q67N85       165 D-LTARSVLITGCGPIGIMSVPVAKMAGAEiVMAMDINEYRLQLAGQlGADVLINPTKQDPv-eVVRSYTRgyGADVVLE 242 Symbiobacterium...
EDP83287     165 E-VSGKTVAVIGCGPIGLMAVGIAKASGASsVIAFDLNPYRLELAGQmGADHLIHSGEQDPl-dEVDKLTSgnGVDVVCE 242 Bacillus seleni...
Q65JE7       165 M-TAGVKVAVVGCGPIGLMAVAVAKASGAAqVIAIDKNEYRLDLALQmGATDIISVEKEDPlknVSALTNGe-GADLVCE 242 Bacillus lichen...
ACB60512     178 D-VSAKTVAIVGCGPIGLMAVSVAKAAGAAeVIAIDVNPYRLELAKTmGADVVIDSRHEDVlerVRMMTDGd-GIDVVCE 255 Exiguobacterium...
EDW23300     165 P-VSGKSVAIFGCGPIGLMAIAVAKASGAVqVFAVDQNEYRLNLAREmGADHIVDIGKDDPv-eVIKQFTRmeGADVICE 242 Bacillus pumilu...
ACQ69357     177 D-VSAKSVAIVGCGPIGLMAVGVAKAAGASlVYAIDVNPYRLKLAEAmGADVVINSLEENPlelIERETDGd-GIDVVCE 254 Exiguobacterium...
O31776       166 Q-PAGGTTAVIGCGPIGLMAVAVAKAAGASqVIAIDKNEYRLRLAKQmGATCTVSIEKEDPl-kIVSALTSgeGADLVCE 243 Bacillus subtilis
Feature 1        ## #  #                ###                      ##                              
2DQ4_A       238 FSGNEaAIHQGLMALIPGGEARILGIPSdPIRFDLAGeLVMRGITAFGIAGRRLWQTWMQGTALVYSGr-VDLSPLLTHR 316 Thermus thermop...
2DFV_A       242 FSGAPkALEQGLQAVTPAGRVSLLGLYPgKVTIDFNNlIIFKALTIYGITGRHLWETWYTVSRLLQSGk-LNLDPIITHK 320 Pyrococcus hori...
YP_001813529 256 MSGHPvAIRQAFEMVTAGGDVNILSLPVkPVEIDLTNhVVFKGVRVQGITGRKMYETWSQVSAFLSSGk-VDVKPLITHT 334 Exiguobacterium...
Q67N85       243 MSGNPtAIRQGLKAARNGARISLLGLPGrPLELDLAAdVIMRGLVLQGITGRRMWQTWYQVRSLYRAGlaERLRPLVTHR 322 Symbiobacterium...
EDP83287     243 MSGHPvAMNQGFKMATNGGRVAVLSLPSkPVEIDVTNdIVFKGLTVQGITGRKMFQTWQQTAGLLRSGr-VDVTPMMTHT 321 Bacillus seleni...
Q65JE7       243 MSGHPtAIRQSLKMAANGGRVHVLSLPEhPVCIDMTNdIVFKGLTVQGITGRKMFETWRQVSGLLQSGt-IQIKPVITHR 321 Bacillus lichen...
ACB60512     256 MSGHPvAIRQAFEMVTAGGDVNILSLPVkPVEIDLTNhVVFKGVRVQGITGRKMYETWSQVSAFLSSGk-VDVKPLITHT 334 Exiguobacterium...
EDW23300     243 MSGHPvAINQALEACANGGKINILSLPErPVTIDITNqIVFRGLTVQGITGRKMFETWRQVSELLRTNt-IDVKPVVTHT 321 Bacillus pumilu...
ACQ69357     255 MSGHPiAIDQAFKMVTAGGDVNVLSLPArPVAIDLTRdVVFKGVRVQGITGRKMYETWSQVSTMLATGq-LNVEPIITHV 333 Exiguobacterium...
O31776       244 MSGHPsAIAQGLAMAANGGRFHILSLPEhPVTIDLTNkVVFKGLTIQGITGRKMFSTWRQVSQLISSNm-IDLAPVITHQ 322 Bacillus subtilis
Feature 1                                  
2DQ4_A       317 LPL-SRYREAFGLLASGqAVKVILDP 341 Thermus thermophilus HB8
2DFV_A       321 YKGfDKYEEAFELXRAGkTGKVVFXL 346 Pyrococcus horikoshii
YP_001813529 335 LPL-ERFEEGFELMRQGkCGKVVLQP 359 Exiguobacterium sibiricum 255-15
Q67N85       323 MPL-EQIDAAMELMGSGqSGKIVLVP 347 Symbiobacterium thermophilum
EDP83287     322 FPL-EEFEKGFDLMIEGnCGKVVLIP 346 Bacillus selenitireducens MLS10
Q65JE7       322 FPM-EEFEKGFELMRKGqCGKVVLIP 346 Bacillus licheniformis ATCC 14580
ACB60512     335 LPL-ERFEEGFELMRQGkCGKVVLQP 359 Exiguobacterium sibiricum 255-15
EDW23300     322 LPF-EQFEKGFELMRNGmCGKVVLMM 346 Bacillus pumilus ATCC 7061
ACQ69357     334 FKL-EEFEKGFELMRAGkCGKVVLIP 358 Exiguobacterium sp. AT1b
O31776       323 FPL-EEFEKGFELMRSGqCGKVILIP 347 Bacillus subtilis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap