Conserved Protein Domain Family
PTKc_Srm_Brk

?
cd05148: PTKc_Srm_Brk 
Catalytic domain of the Protein Tyrosine Kinases, Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and Breast tumor kinase (Brk)
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk (also called protein tyrosine kinase 6) are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) PTKs. Brk has been found to be overexpressed in a majority of breast tumors. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Srm and Brk however, lack the N-terminal myristylation sites. Src proteins are involved in signaling pathways that regulate cytokine and growth factor responses, cytoskeleton dynamics, cell proliferation, survival, and differentiation. The Srm/Brk subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133248
View PSSM: cd05148
Aligned: 6 rows
Threshold Bit Score: 474.616
Threshold Setting Gi: 47211704
Created: 4-Aug-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      # ###   #            # #                                           
NP_543013     223 WERPHSEFALGRKLGEGYFGEVWEGLWLg-SLPVAIKVIKSANm-kLTDLAKEIQTLKGLRHERLIRLHAVCSggEPVYI 300  human
XP_417420     223 WERPRWEFTLRRKLGEGYFGEVWEGLWRn-TVPVAIKIIKADMk--AEDFTKEIQNLKRLRHEKLIQLHAVCSldEPVYI 299  chicken
CAF88760      233 WERPREEFRLLRKLGEGHFGEVWEALWSteNRRVAIKTLKQEDt-kQDEFVKEVQALKSLHHPKLIQLLAMCSrgEPVYI 311  Tetraodon nig...
8928302       184 WERPREEFTLCRKLGSGYFGEVFEGLWKd-RVQVAIKVISRDNllhQQMLQSEIQAMKKLRHKHILALYAVVSvgDPVYI 262  human
CAF88761      824 WELPKKEFELEEELGSGCFARVYRGRWKn-LIRVAVKILKSDSelnHGDFQTEVQILKNLRHRHLLSLFAVCTesRPYWI 902  Tetraodon nig...
NP_001070140  241 WELPKEEFQLENQLGSGHFADVYSGKWKn-HSKVAIKILKNNDalvLREFQLEVQIMKRLRHKHLISLFAVCTssSPFYI 319  zebrafish
Feature 1          ####   #                                        #   ## #          #            
NP_543013     301 VTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDDGLACKVADFGLARLLKDDIY 380  human
XP_417420     300 ITELMRKGNLHSYLNSPEGKSLGTSHLLNIACQVADGMRYLEEKHIVHRDLAARNILVGEELTCKIADFGLARLLKDDIY 379  chicken
CAF88760      312 VTELMTKGSLKAYLASAEGQVLTSAHLIYMGSQIAEGMAYLEDRNIVHRDLAARNILVGEDLVCKVADFGLARIIKDSVY 391  Tetraodon nig...
8928302       263 ITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVY 342  human
CAF88761      903 ITELMEKGSLLIFLRSPEGQNQDVASLIDMGTQVADGMSYLEEQKSIHRDLAARNVLVGEDYTCKVGDFGLARVIKEPFY 982  Tetraodon nig...
NP_001070140  320 ITELIEKGDLLHFLRNPEGRSLQMESLIDMAAQVADGMAYLEANNSIHRDLAARNVLVGDGYVCKIADFGLARIIKEPVY 399  zebrafish
Feature 1             #####        #                                                              
NP_543013     381 SPSsSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVFTYGQCPYEGMT----------------------------- 431  human
XP_417420     380 STSsSTKIPVKWTAPEAANYRTYSLKSDVWSYGILLYEVFTYGQIPYEGMT----------------------------- 430  chicken
CAF88760      392 TASrNTKIPVRWTAPEAAIHQRFSVKSDVWSFGVLLYEMMSRGKMPYEGRNqpgagwnsrp------------hapflsa 459  Tetraodon nig...
8928302       343 LSH-DHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMS----------------------------- 392  human
CAF88761      983 ITE-DKKIPYKWTAPEAISHGKFSNKSDVWSFGILLYEITTYGGVPYPGALfsrswshdqrpgsvlrvdaqcvspvssst 1061 Tetraodon nig...
NP_001070140  400 LSD-DKKIPYKWTAPEAIGHGTYSSKSDVWSFGILLYEIVTHGGIPYPGVN----------------------------- 449  zebrafish
Feature 1            #                                                    
NP_543013     432 ---NHETLQQIM-RGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAI 483  human
XP_417420     431 ---NQETIRQIT-RGYRLPRPSSCPPEIYSIMLECWSGNTEERPTFLALREKLGFI 482  chicken
CAF88760      460 gknNKEVLDLLA-SGFRLPCPTRCPQNIYRMMMGCWAAEPSKRPSFHALHSQLDAI 514  Tetraodon nigroviridis
8928302       393 ---NHEAFLRVD-AGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSF 444  human
CAF88761     1062 amsVQEAYQQVT-AGYRMPAPAKCPHFLYQIMLKCWAAEPDDRPDFRTLKVELDNS 1116 Tetraodon nigroviridis
NP_001070140  450 ---TGEVYDLITkENYRMPSPPKCPQAIYNIMRACWRIESVDRPNFKVLKDELDNY 502  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap