Conserved Protein Domain Family
PTKc_PDGFR_beta

?
cd05107: PTKc_PDGFR_beta 
Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor PTK (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-DD induce PDGFR beta homodimerization. PDGFR signaling plays many roles in normal embryonic development and adult physiology. PDGFR beta signaling leads to a variety of cellular effects including the stimulation of cell growth and chemotaxis, as well as the inhibition of apoptosis and GAP junctional communication. It is critical in normal angiogenesis as it is involved in the recruitment of pericytes and smooth muscle cells essential for vessel stability. Aberrant PDGFR beta expression is associated with some human cancers. The continuously-active fusion proteins of PDGFR beta with COL1A1 and TEL are associated with dermatofibrosarcoma protuberans (DFSP) and a subset of chronic myelomonocytic leukemia (CMML), respectively. The PDGFR beta subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133238
View PSSM: cd05107
Aligned: 3 rows
Threshold Bit Score: 885.122
Threshold Setting Gi: 82071582
Created: 10-Jul-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:includes ATP binding and substrate binding sites
  • Comment:Based on the structures of other PTK family members bound to substrate peptides and ATP analogs, as well as the structure of human c-Kit bound to MgADP.
  • Citation:PMID 9312016

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                     ## #### #                 # #       
P79749        558 YEIRWKVIESVSQDGHEYIYVDPIHLPYDLAWEMPRDNLVLGRTLGSGAFGRVVEATAHGLSHSQSSIKVAVKMLKATAR 637  torafugu
XP_001233830  558 YEIRWKVIESVSSDGHEYIYVDPMQLPYDSSWEVPRDKLVLGRTLGSGAFGRVVEATAHGLSHSQSTMKVAVKMLKSTAR 637  chicken
EAW61746      563 YEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTAR 642  human
Feature 1                                                 # #   #                                 
P79749        638 RSETQALMSELKIMSHLGPHLNIVNLLAACTKHGPLYLVTEYCRYGDLVDYLHRNKHTFLQYYLDKNQddg-slISGGST 716  torafugu
XP_001233830  638 SSEKQALMSELKIMSHLGPHLNIVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQSYGEKARre--aeLYGNTI 715  chicken
EAW61746      643 SSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRppsaelYSNALP 722  human
Feature 1                                                                                         
P79749        717 PLSQRKGYVSFgSESDGGYMDMSKDEPavYVPMQEQMDTIKYADIQPSPYESPY--QQDLYQEQGGGrvdLVISDSPALT 794  torafugu
XP_001233830  716 KEDHVQSHLSLsVESDGGYMDMSKDESldYVPMSDMKGEVKYADIESSNYGTPYelDSYSPSAPERTdrvTLINESPLLS 795  chicken
EAW61746      723 VGLPLPSHVSLtGESDGGYMDMSKDESvdYVPMLDMKGDVKYADIESSNYMAPY--DNYVPSAPERTcraTLINESPVLS 800  human
Feature 1                                   #   ## #          #                 #####        #    
P79749        795 YDDLLGFSYQVAKGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMHDSNYISKGSTFLPLKWMAPESIFHnL 874  torafugu
XP_001233830  796 YMDLVGFSFQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNnL 875  chicken
EAW61746      801 YMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNsL 880  human
Feature 1                                       #                                                 
P79749        875 YTTLSDVWSYGILLWEIFTLGGTPYPDLPMNELFYSPLKRGYRMAKPAHASDEVYEIMKRCWDETFEKRPDFSFLVHCVG 954  torafugu
XP_001233830  876 YTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMSKPTHASDEIYDIMQKCWEEKFEIRPSFSQLVVLMG 955  chicken
EAW61746      881 YTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLE 960  human
Feature 1             
P79749        955 DMLT 958  torafugu
XP_001233830  956 NLLV 959  chicken
EAW61746      961 RLLG 964  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap