Conserved Protein Domain Family
PTKc_PDGFR_alpha

?
cd05105: PTKc_PDGFR_alpha 
Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor PTK (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-AB, and PDGF-CC induce PDGFR alpha homodimerization. PDGFR signaling plays many roles in normal embryonic development and adult physiology. PDGFR alpha signaling is important in the formation of lung alveoli, intestinal villi, mesenchymal dermis, and hair follicles, as well as in the development of oligodendrocytes, retinal astrocytes, neural crest cells, and testicular cells. Aberrant PDGFR alpha expression is associated with some human cancers. Mutations in PDGFR alpha have been found within a subset of gastrointestinal stromal tumors (GISTs). An active fusion protein FIP1L1-PDGFR alpha, derived from interstitial deletion, is associated with idiopathic hypereosinophilic syndrome and chronic eosinophilic leukemia. The PDGFR alpha subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 173653
View PSSM: cd05105
Aligned: 3 rows
Threshold Bit Score: 881.284
Threshold Setting Gi: 82100806
Created: 26-Mar-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:includes ATP binding and substrate binding sites
  • Comment:Based on the structures of other PTK family members bound to substrate peptides and ATP analogs, as well as the structure of human c-Kit bound to MgADP.
  • Citation:PMID 9312016

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                  ## #### #                 # #       
Q8AXC7     531 YEIRWRVIESVSPDGHEYIYVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTAR 610  torafugu
P26619     557 YEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSGAFGKVVEGAAYGLSRSQPVMKVAVKMLKPTAR 636  African clawed frog
NP_990080  555 YEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTAR 634  chicken
Feature 1                                              # #   #                                 
Q8AXC7     611 SSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRESFLNPKPEKsnkKELDIFGINPA 690  torafugu
P26619     637 SSEKQALMSELKIMTHLGAHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKp-kKDLDIFGLNPA 715  African clawed frog
NP_990080  635 SSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKp-kKDLDIFGMNPA 713  chicken
Feature 1                                                                                      
Q8AXC7     691 DESSRSYVILSFESKGDYMDMKQADNTQYVPMLEISNASKYSDLQGSNYDHPPSQ--KGSNDGEMDQLLSDNMSEGLTTN 768  torafugu
P26619     716 DESTRSYVILSFENNGDYMDMKQADTMQYVPMLEMKEPSKYSDIQRSLYDRPASY--KKKPLSEVKNILSDDGFEGLTVL 793  African clawed frog
NP_990080  714 DESTRSYVILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYkkKSLSESEVKNLLSDDGSEGLSLL 793  chicken
Feature 1                              #   ## #          #                 #####        #      
Q8AXC7     769 DLLSFTYQVAKGMEFLASKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYT 848  torafugu
P26619     794 DLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYT 873  African clawed frog
NP_990080  794 DLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYT 873  chicken
Feature 1                                  #                                                   
Q8AXC7     849 TLSDVWSYGILLWEIFSLGGTPYPGMIVDSSFYNKIKSGYRMSKPEHAPQDVYDMMMKCWNSEPEKRPSFLGLSDTIASL 928  torafugu
P26619     874 TLSDVWSFGILLWEIFSLGGTPYPGMIVDSTFYNKIKSGYRMAKPDHATHEVYDIMVKCWNSEPEKRPSFRHLSDIVESL 953  African clawed frog
NP_990080  874 TLSDVWSYGILLWEIFSLGGILYPGMMVDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNNEPEKRPSFYHLSEIVESL 953  chicken
Feature 1         
Q8AXC7     929 LPS 931  torafugu
P26619     954 LPM 956  African clawed frog
NP_990080  954 LPG 956  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap