Conserved Protein Domain Family
PTKc_FGFR3

?
cd05100: PTKc_FGFR3 
Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Many FGFR3 splice variants have been reported with the IIIb and IIIc isoforms being the predominant forms. FGFR3 IIIc is the isoform expressed in chondrocytes, the cells affected in dwarfism, while IIIb is expressed in epithelial cells. FGFR3 ligands include FGF1, FGF2, FGF4, FGF8, FGF9, and FGF23. It is a negative regulator of long bone growth. In the cochlear duct and in the lens, FGFR3 is involved in differentiation while it appears to have a role in cell proliferation in epithelial cells. Germline mutations in FGFR3 are associated with skeletal disorders including several forms of dwarfism. Some missense mutations are associated with multiple myeloma and carcinomas of the bladder and cervix. Overexpression of FGFR3 is found in thyroid carcinoma. FGFR3 is part of the FGFR subfamily, which are receptor PTKs (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to more that one type of receptor. The FGFR3 subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 173652
View PSSM: cd05100
Aligned: 3 rows
Threshold Bit Score: 701.777
Threshold Setting Gi: 2497569
Created: 10-Jul-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        ## # ## #                   # #                              
Q61851    453 LPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNI 532 house mouse
Q91287    444 LPADPKWELSRSRLTLGKPLGEGCFGQVVMADAVGIEKDKPNKATSVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNI 523 Iberian ribbed newt
CAM73234  449 LPSDPKWEFTRTKLTLGKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTDKDLSDLVSEMEMMKMIGKHKNI 528 zebrafish
Feature 1                     ####  ##                                                      # 
Q61851    533 INLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDL 612 house mouse
Q91287    524 INLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMDYSFDTCKLPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDL 603 Iberian ribbed newt
CAM73234  529 INLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASKKCIHRDL 608 zebrafish
Feature 1       ## #          #                 #####        #                                
Q61851    613 AARNVLVTEdNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTPgGPSPYPG 692 house mouse
Q91287    604 AARNVLVTDdNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPG 682 Iberian ribbed newt
CAM73234  609 AARNVLVTEdNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTL-GGSPYPG 687 zebrafish
Feature 1       #                                                                             
Q61851    693 IPVEELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDT 772 house mouse
Q91287    683 IPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSVPFEQYSPACPDS 762 Iberian ribbed newt
CAM73234  688 IPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDHDRVLSMTSTDEYLDLSVPFEQYSPTCPDS 767 zebrafish
Feature 1                    
Q61851    773 PSSSSSGDDSVFTHD 787 house mouse
Q91287    763 HSSCSSGDDSVFAHD 777 Iberian ribbed newt
CAM73234  768 NSTCSSGDDSVFAHD 782 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap