2OO8,2WQB


Conserved Protein Domain Family
PTKc_Tie2

?
cd05088: PTKc_Tie2 
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Tyrosine Kinase, Tie2
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor PTK (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of Ang-1 to Tie2 leads to receptor autophosphorylation and activation, promoting cell migration and survival. In contrast, Ang-2 binding to Tie2 does not result in the same response, suggesting that Ang-2 may function as an antagonist. Tie2 signaling plays key regulatory roles in vascular integrity and quiescence, and in inflammation. The Tie2 subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133219
View PSSM: cd05088
Aligned: 5 rows
Threshold Bit Score: 599.676
Threshold Setting Gi: 16580116
Created: 11-Jul-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    ## ##   #              # #                #   #         #         
2OO8_X       9 YPVLDWNDIKFQDVIGEGNFGQVLKARIKKDgLRMDAAIKRMKEYAskDDHRDFAGELEVLCKLgHHPNIINLLGACEHR 88   human
2WQB_A      16 YPVLDWNDIKFQDVIGEGNFGQVLKARIKKDgLRMDAAIKRMKEYAskDDHRDFAGELEVLCKLgHHPNIINLLGACEHR 95   human
O73791     808 FPALQWSDIQFQDVLGEGNFGQVLKARIRKDgLRMDAAVKRMKDYAsqDDHRDFAGELEVLCRLgPHKNIIHLLGACEHR 887  zebrafish
AAK72490   350 YPVLEWHNIKFKDVIGEGNFGQVLKARIKKDgLRMDAAIKRMKEYAskDDHRDFAGELEVLSKLgSHPNIINLLGACEHR 429  African clawed frog
XP_424944  819 YPVLEWNDIKFQDVIGEGNFGQVLKARIKKDgLRMDAAIKRMKEYAskDDHRDFAGELEVLCKLgHHPNIINLLGACEHR 898  chicken
Feature 1            ####  ##                                                          ## #    
2OO8_X      89 gYLYLAIEYApHGNLLDFLRKSRVlETDPAFAIANSTasTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGEn 168  human
2WQB_A      96 gYLYLAIEYApHGNLLDFLRKSRVlETDPAFAIANSTasTLSSQQLLHFAADVARGMDYLSQKQFIHRNLAARNILVGEn 175  human
O73791     888 gYLYLAIEFApHGNLLDFLRKSRVlETDPAFAIAHRTasTLSSQQLLAFSADVARGMSYLSQKQFIHRDLAARNVLVGEn 967  zebrafish
AAK72490   430 gYLYLAIEYApHGNLLDFLRKSRVlETDPAFAIANSTasTLSSQQLLCFAADVARGMDYLSQKQFIHRDLAARNILVGEn 509  African clawed frog
XP_424944  899 gYLYLAIEYApHGNLLDFLRKSRVlETDPAFAIANSTasTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGEn 978  chicken
Feature 1            #                                                                         
2OO8_X     169 YVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYsVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPqGY 248  human
2WQB_A     176 YVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYsVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPqGY 255  human
O73791     968 FVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYsVYTTNSDVWSYGVLLWEVVSLGGTPYCGMTCAELYEKLPlGF 1047 zebrafish
AAK72490   510 FLAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYsVYTSNSDVWSFGVLLWEIVSLGGTPYCGLTCAELYEKLPqGY 589  African clawed frog
XP_424944  979 YVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYsVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPqGY 1058 chicken
Feature 1                                                                     
2OO8_X     249 RLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDC 311  human
2WQB_A     256 RLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDC 318  human
O73791    1048 RLEKPLNCDDEVYELMQQCWREKPFERPSFSQILLSLGRMLEERKTYVNTTLYEKFTYAGIDC 1110 zebrafish
AAK72490   590 RLEQPLNCDDEVYDLMRQCWREKPYERPSFAKIVVSLNRMLEERKTYVNTTLYEKFTYAGIDC 652  African clawed frog
XP_424944 1059 RLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDC 1121 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap