1K3A,1M7N,1JQH


Conserved Protein Domain Family
PTKc_IGF-1R

?
cd05062: PTKc_IGF-1R 
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor PTK (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, where it is frequently overexpressed, IGF-1R is implicated in proliferation, the suppression of apoptosis, invasion, and metastasis. IGF-1R is being developed as a therapeutic target in cancer treatment. The IGF-1R subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133193
View PSSM: cd05062
Aligned: 6 rows
Threshold Bit Score: 543.472
Threshold Setting Gi: 17943043
Created: 7-May-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 23 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:includes ATP binding and substrate binding sites
  • Structure:1K3A; Human IGF-1R tyr kinase binds AMP-PCP and substrate IRS-1 peptide; defined at 3.5A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   # ###   #                 #                                        
1K3A_A       5 WEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSq 84   human
1M7N_B      20 WEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSq 99   human
1JQH_A      14 WEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSq 93   human
CAK04386   990 WEVAREKITMCRELGQGSFGMVYEGIAKGVVKDEPETRVAIKTVNESASVRERIEFLNEASVMKEFNCHHVVRLLGVVSq 1069 zebrafish
NP_990363  993 WEVPREKITMCRELGQGSFGMVYEGIAKGVVKDEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSq 1072 chicken
O73798     988 WEVPREKITMNRELGQGSFGMVYEGIAKGVVKDEAETKVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSq 1067 African clawed frog
Feature 1              # #                                                    #   #  #         
1K3A_A      85 gQPTLVIMELMTRGDLKSYLRSLRPemennpvlAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEdFTVKI 164  human
1M7N_B     100 gQPTLVIMELMTRGDLKSYLRSLRPemennpvlAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEdFTVKI 179  human
1JQH_A      94 gQPTLVIMELMTRGDLKSYLRSLRPemennpvlAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEdFTVKI 173  human
CAK04386  1070 gQPTLVIMELMTRGDLKSHLRSLRSkeqgsssqSLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEdFTVKI 1149 zebrafish
NP_990363 1073 gQPTLVIMELMTRGDLKSYLRSLRPdtesnpgqAPPTLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEdFTVKI 1152 chicken
O73798    1068 gQPTLVIMELMTRGDLKSYLRSLRPdtesnsgqPTPSLKKMIQMAGEIADGMSYLNANKFVHRDLAARNCMVTEdFTVKI 1147 African clawed frog
Feature 1       #                ######       ## ##                              #             
1K3A_A     165 GDFGMTRDIXETDXXRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLL 244  human
1M7N_B     180 GDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLL 259  human
1JQH_A     174 GDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLL 253  human
CAK04386  1150 GDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLL 1229 zebrafish
NP_990363 1153 GDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGMTNEQVLRFVMEGGLL 1232 chicken
O73798    1148 GDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLL 1227 African clawed frog
Feature 1                                           
1K3A_A     245 DKPDNcpDMLLELMRMCWQYnPKMRPSFLEIISSIKE 281  human
1M7N_B     260 DKPDNcpDMLFELMRMCWQYnPKMRPSFLEIISSIKE 296  human
1JQH_A     254 DKPDNcpDMLFELMRMCWQYnPKMRPSFLEIISSIKE 290  human
CAK04386  1230 DKPDNcpDMLFELMRMCWQYnPKMRPSFLEIINSIKE 1266 zebrafish
NP_990363 1233 EKPDNcpDMLFELMRMCWQYnPKMRPSFLEIISSIKD 1269 chicken
O73798    1228 EKPDNcpDMLFELMRMCWQFnPKMRPSFLEIISSIKD 1264 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap