1MP8,2J0M,3BZ3,2J0L,3CC6


Conserved Protein Domain Family
PTKc_FAK

?
cd05056: PTKc_FAK 
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) PTK that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions and at growth factor receptors. Through diverse molecular interactions, FAK functions as a biosensor or integrator to control cell motility. It is a key regulator of cell survival, proliferation, migration and invasion, and thus plays an important role in the development and progression of cancer. Src binds to autophosphorylated FAK forming the FAK-Src dual kinase complex, which is activated in a wide variety of tumor cells and generates signals promoting growth and metastasis. FAK is being developed as a target for cancer therapy. The FAK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133187
View PSSM: cd05056
Aligned: 13 rows
Threshold Bit Score: 512.738
Threshold Setting Gi: 15150650
Created: 17-Jul-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #####   #                                       # #                
1MP8_A      10 YEIQRERIELGRCIGEGQFGDVHQGIYMSpe------------------------nPALAVAIKTCKNCts-----dSVR 60   human
Q91738     428 YEIQRDRIELGRCIGEGQFGDVHQGVYMSpe------------------------nPAMAVAIKTCKNCts-----dSVR 478  African clawed frog
AAP36454   419 YEIQRDRIELGRCIGEGQFGDVHQGVYISpe------------------------nPSLSVAIKTCKNCts-----dSVR 469  zebrafish
AAH84174   256 FTISRSDVALGRILGEGFFGEVYDGVYVKpk------------------------gDKINVAVKTCKNDca-----aDVK 306  western clawed frog
CAD35931   410 VGLSRKDISLKRMLGEGFFGEVHEGVYQKkn------------------------gEKVNVAVKTCKECa------pDIR 459  zebrafish
AAV97963   422 YEVARDDLTLDEIIGQGQFGDVYQGTFKSki-----------------------ssVEIPVAVKTYKIEldkeqedgTRA 478  Hydractinia echi...
BAA85188   450 YELDRSLITPSAKIGVGQFGDVYVGTYTLpklgkgknlagngknsnsdqrnadsrpDVIQVAIKTCKANdd-----pEKT 524  fruit fly
AAK85457   360 IRLRRELITLKELIGGGQFGNVYKAVYHDle-----------------------kdERIAVAVKVCKTDae-----pADT 411  nematode
AAN38839   431 YEISRELVTLVETIGQGQFGDVHKGIYIDq-------------------------dEKVEVAVKTCKVEst-----qALG 480  green sea urchin
2J0M_B       5 YEIQRERIELGRCIGEGQFGDVHQGIYMSpe------------------------nPALAVAIKTCKNCts-----dSVR 55   chicken
3BZ3_A       2 YEIQRERIELGRCIGEGQFGDVHQGIYMSpe------------------------nPALAVAIKTCKNCts-----dSVR 52   human
2J0L_A       5 YEIQRERIELGRCIGEGQFGDVHQGIYMSpe------------------------nPAMAVAIKTCKNCts-----dSVR 55   chicken
3CC6_A       7 YGIAREDVVLNRILGEGFFGEVYEGVYTNhk------------------------gEKINVAVKTCKKDct-----lDNK 57   human
Feature 1           #            #              ####  ##                                       
1MP8_A      61 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKysLDLASLILYAYQLSTALAYLESKRFVHR 140  human
Q91738     479 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKysLDLASLILYSYQLSTALAYLESKRFVHR 558  African clawed frog
AAP36454   470 EKFLQEALTMRQFDHPHIVKLIGIITEnPVWIIMELCTLGELRSFLQVRKynLDLSTLILFAYQLSTALAYLESKRFVHR 549  zebrafish
AAH84174   307 EKFMSEAYLMRNLDHPHIVKLIGIIEDdPIWIVMELYPYGELGQYLEKNKnsLQVLSLILYSLQICKALAYLEGINCVHR 386  western clawed frog
CAD35931   460 EKFVGEAVIMKNLDHPHIVRLIGVIEEdPVWIVMELCQQGELGKYLTKNQqsLTSVTLVLFSLQLCKALVYLQGMNMVHR 539  zebrafish
AAV97963   479 EKFLEEAYLMQQFDHPHVIKLIGIVSDsPSYIIMELASYGELRSYLQQYRtqTESERLLTYIYQLSTALSYLESRNFVHR 558  Hydractinia echi...
BAA85188   525 ENFLAEAYIMQKFDHPHIIRLIGICSVmPIWIVMELAKLGELRAYLKTNSerLSHGTLLKYCYQLSTALSYLESKKFVHR 604  fruit fly
AAK85457   412 QLILQESSLMRNFRHSNIIQLIGVCVDqPMWLVLELAPKGELREYLQQEKdwLPLRILTLFCSQICDSLVYLHSTRFVHR 491  nematode
AAN38839   481 ERFLEEAYIMKQFDHPHIIKLIGVCTDpPIWIVMELAPFGEMRMFLQTHKeeLTLASLILYAYQLSMALSYLESKKFVHR 560  green sea urchin
2J0M_B      56 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKysLDLASLILYAYQLSTALAYLESKRFVHR 135  chicken
3BZ3_A      53 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKysLDLASLILYAYQLSTALAYLESKRFVHR 132  human
2J0L_A      56 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKfsLDLASLILYAYQLSTALAYLESKRFVHR 135  chicken
3CC6_A      58 EKFMSEAVIMKNLDHPHIVKLIGIIEEePTWIIMELYPYGELGHYLERNKnsLKVLTLVLYSLQICKAMAYLESINCVHR 137  human
Feature 1          ## #          #                                                             
1MP8_A     141 DIAARNVLVSSnDCVKLGDFGLSRYMEDS-TYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF 218  human
Q91738     559 DIAARNVLVSSsDCVKLGDFGLSRYMEDS-TYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGVKPF 636  African clawed frog
AAP36454   550 DIAARNVLVSSiDCVKLGDFGLSRYMEDS-SYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMFGIKPF 627  zebrafish
AAH84174   387 DIAVRNILVASpECVKLGDFGLSRYLEEE-EYYKAS-VTRLPIKWMAPESINFRRFTSASDVWMFGVCMWEILSFGKQPF 464  western clawed frog
CAD35931   540 DIAVRNVLVATpECVKLGDFGLSRYIEDE-EYYKAS-VTRLPIKWMAPESINFRRFTAASDVWMFAVCVWEIMNRGKQPF 617  zebrafish
AAV97963   559 DIAARNILAADpHTIKLADFGLSRWIDEEqSYYKAS-KGKLPIKWMAPESINFRRFSSASDVWMFGVCCWEILMYGVKPF 637  Hydractinia echi...
BAA85188   605 DIAARNVLVSSpTCVKLADFGLSRWVSDQ-SYYHSTpTVALPIKWMSPESINFRRFTTASDVWMFGVCIWEILMLGVKPF 683  fruit fly
AAK85457   492 DIAARNILVCSpQCVKLADFGLSRALDYD-AVYTAS-RGKLPIKWLAPESVNYRQFSMASDVWMFGVCMWEIFSLGVKPW 569  nematode
AAN38839   561 DIAARNLLVVAkDNVKLGDFGLSRLLHDH-SYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGVKPF 638  green sea urchin
2J0M_B     136 DIAARNVLVSSnDCVKLGDFGLSRYMEDS-TYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF 213  chicken
3BZ3_A     133 DIAARNVLVSSnDCVKLGDFGLSRYMEDS-TYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF 210  human
2J0L_A     136 DIAARNVLVSSnDCVKLGDFGLSRYMEDS-TXXKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF 213  chicken
3CC6_A     138 DIAVRNILVASpECVKLGDFGLSRYIEDE-DYYKAS-VTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPF 215  human
Feature 1                                                                    
1MP8_A     219 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 279  human
Q91738     637 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 697  African clawed frog
AAP36454   628 QGVKNNDVIGRIENGERLAMPQNCPPTLYSLMTK-CWAYDPSKRPRFTELKTQLSTILDEEK 688  zebrafish
AAH84174   465 FWLENKDVISVIEKGDRLPKPEMCPPTLYTLMTR-CWTYDPFERPKFTELVCSLSDIYQTEK 525  western clawed frog
CAD35931   618 HWLDNRDVINQLEQGNRLPKPEQCPPALYSLMTR-CWSYDPRERPTFTELACNISDVHQMEK 678  zebrafish
AAV97963   638 QGVPNEKVIGKIENGERLPLPPNCAPTLYHLMTE-SWHYEPSKRPTFQELKSRLSQIKYEES 698  Hydractinia echinata
BAA85188   684 QGVKNSDVILKLENGERLPLPPNCPPRLYSLMSQ-CWAYEPLKRPNFKRIKETLHEILIEDS 744  fruit fly
AAK85457   570 AGVTNSDVIMHIEQGSRPPCPEKCPTALYNFIRSkMWAIEPHKRPTVDQIYAIIEDVRQQII 631  nematode
AAN38839   639 QGVKNNEVIGRIENGERLPMPAACPPTLYSVMTL-CWSYEPSKRPNFKDLKTRLNEILEEEK 699  green sea urchin
2J0M_B     214 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 274  chicken
3BZ3_A     211 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 271  human
2J0L_A     214 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 274  chicken
3CC6_A     216 FWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR-CWDYDPSDRPRFTELVCSLSDVYQMEK 276  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap