1RJB,3G0E,1PKG,2I1M


Conserved Protein Domain Family
PTKc_PDGFR

?
cd05055: PTKc_PDGFR 
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. They are receptor PTKs (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR subfamily receptors are important in the development of a variety of cells. PDGFRs are expressed in a many cells including fibroblasts, neurons, endometrial cells, mammary epithelial cells, and vascular smooth muscle cells. PDGFR signaling is critical in normal embryonic development, angiogenesis, and wound healing. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem cells, the interstitial cells of Cajal, and the pacemaker cells of the GI tract. CSF-1R signaling is critical in the regulation of macrophages and osteoclasts. Mammalian FLT3 plays an important role in the survival, proliferation, and differentiation of stem cells. The PDGFR subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase .
Statistics
?
PSSM-Id: 133186
View PSSM: cd05055
Aligned: 8 rows
Threshold Bit Score: 582.907
Threshold Setting Gi: 82071582
Created: 10-Jul-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 24 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:includes ATP binding and substrate binding sites
  • Comment:Based on the structures of other PTK family members bound to substrate peptides and ATP analogs, as well as the structure of human c-Kit bound to MgADP.
  • Citation:PMID 9312016

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                  ## #### #                 # #       
1RJB_A       9 YESQLQMVQVtgssdnEYFYVDFReyEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAYGISktgVSIQVAVKMLKEKad 88   human
3G0E_A      12 YEVQWKVVEEin--gnNYVYIDPTqlPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIksdAAMTVAVKMLKPSah 89   human
1PKG_B       5 YEVQWKVVEEin--gnNXVXIDPTqlPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIksdAAMTVAVKMLKPSah 82   human
2I1M_A      12 YQVRWKIIESye--gnSYTFIDPTqlPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGkedAVLKVAVKMLKSTah 89   human
Q8AXC7     531 YEIRWRVIESvspdghEYIYVDPMqlPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSrsqPVMKVAVKMLKPTar 610  torafugu
P79749     558 YEIRWKVIESvsqdghEYIYVDPIhlPYDLAWEMPRDNLVLGRTLGSGAFGRVVEATAHGLShsqSSIKVAVKMLKATar 637  torafugu
Q00495     544 YQVRWKIIERye--gnSYTFIDPTqlPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGkedAVLKVAVKMLKSTah 621  Norway rat
AAC50969   549 YEVQWKVVEEin--gnNYVYIDPTqlPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIksdAAMTVAVKMLKPSah 626  human
Feature 1                                              # #   #                                 
1RJB_A      89 sseREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFsedeieyenqk---------- 158  human
3G0E_A      90 lteREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFicsktspa------------- 156  human
1PKG_B      83 lteREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFicsktspa------------- 149  human
2I1M_A      90 adeKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKSRVLetdpaf--------------- 154  human
Q8AXC7     611 sseKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRESFlnpkpeksnkkeldifginpa 690  torafugu
P79749     638 rseTQALMSELKIMSHLGPHLNIVNLLAACTKHGPLYLVTEYCRYGDLVDYLHRNKHTFlqyyldknqddgslisggstp 717  torafugu
Q00495     622 adeKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMlgpslspgqdsegdssyknih 701  Norway rat
AAC50969   627 lteREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFicskqedhaeaalyknllhsk 706  human
Feature 1                                                                                      
1RJB_A     159 -----------------------------------------------------------------rleeeedlnvLTFED 173  human
3G0E_A     157 -------------------------------------------------------------------imeddelaLDLED 169  human
1PKG_B     150 -------------------------------------------------------------------imeddelaLDLED 162  human
2I1M_A     155 ---------------------------------------------------------------------aianstASTRD 165  human
Q8AXC7     691 dessrsyvilsfeskgdymdmkqadnt-qyvpmleisnaskysdlqgsnydhppsqkgsndgemdqllsdnmsegLTTND 769  torafugu
P79749     718 lsqrkgyvsfgsesdggymdmskdepavyvpmqeqmdtikyadiqpspyespyqqdlyqeqgggrvdlvisdspaLTYDD 797  torafugu
Q00495     702 lekkyvrrdsgfs-----------------------------sqgvdtyvemrpvstsssdsffkqdldkepsrpLELWD 752  Norway rat
AAC50969   707 esscsdstneymdmkp----------------------gvsyvvptkadkrrsvrigsyierdvtpaimeddelaLDLED 764  human
Feature 1                             #   ## #          #                 #####        #       
1RJB_A     174 LLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWMAPESLFEgIYTI 253  human
3G0E_A     170 LLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNcVYTF 249  human
1PKG_B     163 LLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNcVYTF 242  human
2I1M_A     166 LLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDcVYTV 245  human
Q8AXC7     770 LLSFTYQVAKGMEFLASKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDnLYTT 849  torafugu
P79749     798 LLGFSYQVAKGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMHDSNYISKGSTFLPLKWMAPESIFHnLYTT 877  torafugu
Q00495     753 LLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESILYcVYTV 832  Norway rat
AAC50969   765 LLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNcVYTF 844  human
Feature 1                                 #                                                    
1RJB_A     254 KSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQL 333  human
3G0E_A     250 ESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQI 329  human
1PKG_B     243 ESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQI 322  human
2I1M_A     246 QSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQA 325  human
Q8AXC7     850 LSDVWSYGILLWEIFSLGGTPYPGMIVDSSFYNKIKSGYRMSKPEHAPQDVYDMMMKCWNSEPEKRPSFLGLSDTIASLL 929  torafugu
P79749     878 LSDVWSYGILLWEIFTLGGTPYPDLPMNELFYSPLKRGYRMAKPAHASDEVYEIMKRCWDETFEKRPDFSFLVHCVGDML 957  torafugu
Q00495     833 QSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQA 912  Norway rat
AAC50969   845 ESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQI 924  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap