2IFG


Conserved Protein Domain Family
Ig_TrkABC_d4

?
cd04972: Ig_TrkABC_d4 
Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB, and TrkC
The members here are composed of the fourth domain of Trk receptors TrkA, TrkB, and TrkC, an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains while the fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, TrkB, and TrkC mediate the trophic effects of the neurotrophin Nerve Growth Factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor found in all major NGF targets, including the sympathetic, trigeminal, and dorsal root ganglia, cholinergic neurons of the basal forebrain, and the striatum. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems. The TrkC gene is expressed throughout the mammalian nervous system.
Statistics
?
PSSM-Id: 409361
View PSSM: cd04972
Aligned: 4 rows
Threshold Bit Score: 189.494
Threshold Setting Gi: 402856639
Created: 15-Feb-2007
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:interdomain interface [polypeptide binding site]
Evidence:
  • Structure:2IFG, human TrkA interface between domains 4 and 5; contacts based on 3.5 A distance.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
2IFG_A       160 TLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRA 239 human
XP_010836511 195 TLKIQMSNASVDVGADVLLQCQVEGQGLEQAGWILTELEGSATVMESGSLPSLGLTLANVTSDLNRKNVTCWAENDVGRA 274 Bison bison bison
XP_001929560 195 ELKIQMPNGSVDVGDDVLLQCQVEGQGLEQAGWILMDLEESATVMQSGSLPSLGLTLAHVTSDLNRKNVTCWAENHVGRA 274 Sus scrofa
XP_003892893 221 MLKVQVPNASVDVGDDVLLWCQVEGRGLEQAGWILTELEQSATVMKSGALPSLGLTLANVTSDLNRKNVTCWAENDVGRA 300 Papio anubis
Feature 1              ##
2IFG_A       240 EVSVQVNV 247 human
XP_010836511 275 EVSAQVNV 282 Bison bison bison
XP_001929560 275 EISVQVNV 282 Sus scrofa
XP_003892893 301 ELSVQVNV 308 Papio anubis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap