2CDQ


Conserved Protein Domain Family
ACT_AK1-AT_1

?
cd04933: ACT_AK1-AT_1 
Click on image for an interactive view with Cn3D
ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1)
This CD includes the first of two ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1), which can be synergistically inhibited by S-adenosylmethionine. This isoenzyme is found in higher plants, Arabidopsis thaliana (AT) and Zea mays, and also in Chlorophyta. Like the Escherichia coli AKIII (LysC), Arabidopsis AK1 binds two feedback allosteric inhibitor lysine molecules at the dimer interface located between the ACT1 domain of two subunits. A loop in common is involved in the binding of both Lys and S-adenosylmethionine providing an explanation for the synergistic inhibition by these effectors. Members of this CD belong to the superfamily of ACT regulatory domains.
Statistics
?
PSSM-Id: 153205
View PSSM: cd04933
Aligned: 3 rows
Threshold Bit Score: 147.057
Threshold Setting Gi: 116000390
Created: 30-Mar-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:lysine allosteric regulatory site
Evidence:
  • Structure:2CDQ; Arabidopsis AK1 binds two feedback allosteric inhibitor lysine molecules at the dimer interface located between the ACT1 domain of two subunits.
    View structure with Cn3D
  • Comment:defined by 3.5 Angstrom distance

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               #  # ##             ###    #                                        
2CDQ_A    341 VTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQQELDHVVEELEKIAVVNLLK 418 thale cress
ABO09875  410 VTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIQQELDHVVEELKKFAVVHLLQ 487 Zea mays
CAL50070  278 VTMLDITSTRMLGQYGFLAKVFNIMATNGISVDVVATSEVSVSLTLDPSKLWERDLAKEELEKLKLDFENDGIANVAV 355 Ostreococcus tauri

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap