Conserved Protein Domain Family
ACT_TyrKc

?
cd04928: ACT_TyrKc 
Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains
This CD includes a novel, yet uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains. Members of this CD belong to the superfamily of ACT regulatory domains.
Statistics
?
PSSM-Id: 153200
View PSSM: cd04928
Aligned: 3 rows
Threshold Bit Score: 108.027
Threshold Setting Gi: 54291615
Created: 23-Aug-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL49781 172 MHEITFSTIDKPKLLSQLTSLLGELGLNIQEAHAFSTVDGFSLDVFVVDGWSQEETDGLRDALSKEIL 239 thale cress
BAD62538 170 MHEITFASDDKPKGLTQLSSLLGNLNLDIKEVHALSTNDGYFLDIFIVIGWDHKETQLLEEALEKEIH 237 Japanese rice
CAL54008 157 MYEVAVAAGNKPRLLSRVSAVLFDVGLNIAEAHVFCTDDGLALDIFVVTGWKRGEEAAVGHAVQTALD 224 Ostreococcus tauri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap