Conserved Protein Domain Family
ACT_ACR_1

?
cd04895: ACT_ACR_1 
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein)
This CD includes the N-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
Statistics
?
PSSM-Id: 153167
View PSSM: cd04895
Aligned: 6 rows
Threshold Bit Score: 124.489
Threshold Setting Gi: 125585603
Created: 20-Mar-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001060867  29 ATLVQVDSARKTGVLLEAVQVLADLDLSINKAYISSDGR-WFMDVFHVTDRLGCKL-TDDSVITYIEQSLGTWN 100 Oryza sativa (japonic...
AAK64128      36 CTLIKVDSANKYGILLDMVQVLADLDLVISKCYISSDGE-WFMDVFHVTDQLGNKL-TDRSLILYIQQAICSSR 107 thale cress
AAM65519      35 CTLVKVDSMNKPGILLEVVQVLTDLDLTITKAYISSDGG-WFMDVFHVTDQQGNKV-TDSKTIDYIEKVLGPKG 106 thale cress
NP_197914     37 CTVVKVNSENKQGLLLEVVQILTDMNLIITKSYISSDGG-WFMDVFHVKDEHGNKL-TDKSVINHIKHAIGTSR 108 thale cress
CAB79233      41 TQPSSIDSARSPGILLESVQLLTDMNLWIKKAYISSDGK-WNMDVFHVSDLNGDKL-TDENLIRYIEKSIETSH 112 thale cress
EAZ26267      32 ATLVQVHSARKHGMLLEAVAALSEHGVCVRKGYISSDDGrWFMDVFHVTDAAGRKVaDADALLARLESSLSAEA 105 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap