Conserved Protein Domain Family
HTH_MerR-like_sg7

?
cd04786: HTH_MerR-like_sg7 
Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily
Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 7) with a conserved cysteine present in the C-terminal portion of the protein. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Statistics
?
PSSM-Id: 133413
View PSSM: cd04786
Aligned: 5 rows
Threshold Bit Score: 226.631
Threshold Setting Gi: 17989362
Created: 4-Jan-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
DNA bindingputative dimer
Feature 1:DNA binding residues [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to BmrR and the structure of Bacillus subtilis BmrR bound to DNA (1EXI).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ###             #                ###                                           
YP_625525   1 MRIGELAKLSGISASRIRFYEAEGLITaVERSANGYRDYAdNAVWMLEIISSAQSAGFSLEQIRHLLPVKAGNWQHDGLV 80  Burkholderia cenoc...
NP_902905   1 MKIGELAKRSGMAASAIRFDESKGLLQsASGQANGYRDYPpETAAALAIIRDAQQSGFSLDEIRQILPAGVSSWRHDELL 80  Chromobacterium vi...
ABK38662    1 MKIGELAKQTGMAASTIRFYEARGLLSkVRRGTNGYRDYPpETVPLLTIIGQAQQAGFSLDEIKQLVPADISSWQHAPLL 80  Aeromonas hydrophi...
NP_541995   1 MKIGELAKRSGLAASRIRFYESIGLLKtVDRRSNGYRTYPeEAVLVLHLIATAQKAGFSLDEIRTLLPPDLDNWEHDALI 80  Brucella melitensi...
NP_745134   1 MRIGELAKISGLAPSRIRFYEASGLISsVERKANGYRDYApDTEWVLQLITSAQAAGFSLEEIRQLMPMDASGWRHDELL 80  Pseudomonas putida...
Feature 1                                                        
YP_625525  81 AALERKVAEIEAMQKRLKENKAQLLVAIDSIRNRPTELDCTERTRWVMERL 131 Burkholderia cenocepacia AU 1054
NP_902905  81 ATLRRKVADIESLQARLAQNKSHIQSLIQLIESKPGDMDCADNAARVMAVM 131 Chromobacterium violaceum ATCC 12472
ABK38662   81 AALEAKVSDIEALETRLAHSKQQLQALIRLVESKPDEMPCEENAARVLASM 131 Aeromonas hydrophila subsp. hydrophila ATCC 7966
NP_541995  81 EVLRRKVADIEALEARLARSKLQLLGLISDIEAKPDDMACADNARRVLSRL 131 Brucella melitensis 16M
NP_745134  81 TGLKQKVEEISALEERLAQNKAQLLRVIEGIEGKPEGMACADNAQMLINRL 131 Pseudomonas putida KT2440

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap