Conserved Protein Domain Family
HTH_MerR-like_sg2

?
cd04778: HTH_MerR-like_sg2 
Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily
Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 2). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Statistics
?
PSSM-Id: 133405
View PSSM: cd04778
Aligned: 10 rows
Threshold Bit Score: 214.949
Threshold Setting Gi: 21221610
Created: 4-Jan-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
DNA bindingputative dimer
Feature 1:DNA binding residues [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to BmrR and the structure of Bacillus subtilis BmrR bound to DNA (1EXI).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ###             #                ###                                          
YP_290389     3 EYRIDELARLANTTVRNVRVYQDRGLLS-PPRREGRVGIYTEVHLARLRLIGQLLKRGYTFANIAELVSVWERGGNLSEV 81  Thermobifida fus...
NP_521201     3 EFTIDELARAAATTVRNVRSYQDRGLID-PPERRGRVGIYTQAHLGRLKLINHLLARGYTLANIQELLKALVEGHDLRSI 81  Ralstonia solana...
YP_702067     3 EYRIDDLAREARVSVRNVRVYQDRGLLP-PPRKQGRTGWYNESHLARLHLIGRMLDRGYTFATISELLTAAHYGLQVKDV 81  Rhodococcus sp. ...
NP_825431     2 TYRIEDLAHRSGATVRTIRAYQDRGLLP-RPERRGRANVYADAHLARLRQIAGLLDRGYTLASIKELLEAWDSGRGLGGV 80  Streptomyces ave...
NP_961135    66 EYRIDDLARLAGTTTRNICVYRDRGLLP-PPLRVGRIALFNDTHLTRLRLITSMLDRGYTIAHVREMLSAWEQGKNLGDV 144 Mycobacterium av...
ZP_01277086  18 EYRLNELSRISGVSTRNIRAYRERGLLD-PPRRQGRSAYYNDFHLAQLDTINQLLRRGFSSAHIAEFFASMRAGADLADI 96  Mycobacterium sp...
ZP_01205727  19 EYRLEDLARESGISARNIRAYRERGLLD-PPRRVGRSALYDDYHLSQLNTISQLLRKGYNSAHIAEFFASMRQGTDLADI 97  Mycobacterium va...
YP_119072     3 EYRIDDLARAAGTTSRNVRLYQERGLLPqPVRREGRANIYDDSHLARLQIVNGLLERGFTLAHITDFITSWETGKDLTEI 82  Nocardia farcini...
NP_627389     6 EYRMAELARLAGITVRTVRFYRERKLIP-PPRREGRIAWYDDHHLARLRTIAALLERGHTLNGIAELADAFDHGRDVGDL 84  Streptomyces coe...
ZP_00968290  25 EYSVDELARAAGSSVRNVRAYQDRGLLP-PPERRGRVGVYFDSHLKRLRLISQLLERGYSSANIKELLEAWEQGRDLDHV 103 Pseudomonas aeru...
Feature 1                                                                                       
YP_290389    82 LGFe--------SAVGDPWSDEIPGYMTLEELTDlfgdq-vtpeRVARAVELGLLEPEGk---rYRVPSPRLLHAGAELV 149 Thermobifida fus...
NP_521201    82 LGLe--------AAISSPWSDAFPKHFSLLALAKlfgcs-isrqALARAIGLGLLEPDGl---gYLARNPKLLMAGAQMA 149 Ralstonia solana...
YP_702067    82 LET---------DDPGSRWKKRRRAARLTIAELKrmfgaqtteaNIAKGTELGVLVPAGd---dYSVNDPRLVEAAQVLV 149 Rhodococcus sp. ...
NP_825431    81 LGLv--------AEVDGPWSDEEAGRISRAELSErfggs-pddaAVADALELGVLEPVPghedlFLVPSPQELAVAVELH 151 Streptomyces ave...
NP_961135   145 LGLe--------TAIVGTWTTEKPETMSLAEAQRlvg----dprAFERLVALQVIRVDGs---rATLTRPKLIEAFNEIR 209 Mycobacterium av...
ZP_01277086  97 LGLqrs----lfTAEDGRDETPSAGRDLDLDPSSe---------EAGELVAYGLAEVVDg---rVVFVDPSIAEIVGRAT 160 Mycobacterium sp...
ZP_01205727  98 LGLq-------rAVLGQTPEPRNRNTAVKIDAKSe---------EARKLVAFGMAEVVDg---eVLMIDCAAADILARSP 158 Mycobacterium va...
YP_119072    83 LGLqkavtdawgARHDPVQLPRDAVVALLADLDAeqa----eekHLDRLADLQLVRTDDd---tVTLLRPDLVEVLLELH 155 Nocardia farcini...
NP_627389    85 LGLge------pTEETPVRLTPEELAARFEGEVTp--------eNLAAAMELGYLGTDGd---eLVHISHRLLEVSSALV 147 Streptomyces coe...
ZP_00968290 104 LGLd--------QAIIGEWNLETPGSIGFDELQAifgde-lndrVIDKAQALGLLLFDGe---rMKIPSPRLFQGRAGTV 171 Pseudomonas aeru...
Feature 1                                                                                       
YP_290389   150 EIGMSLDAVLDla------------qeLRDRIDAAAEalnrqvsehiiatyape-giihsedlgkvadvirRVRPLAQIA 216 Thermobifida fus...
NP_521201   150 QAGFPLEEVLDii------------erARPHTQAVADdlvsmvvreldkyekg--qlpppedvprlvdviwRIRPLAAVA 215 Ralstonia solana...
YP_702067   150 DAGIPLEAVLEqt------------aaVRRDLSDVAArfvavvadrylaaegep-leldeakvseiarlvdQMRPLAHDA 216 Rhodococcus sp. ...
NP_825431   152 EAGVPLSAIAGhl------------reLRGQVEHIASrflefttehvfarylge-hppnevdateaaslvrRLRPLAQQT 218 Streptomyces ave...
NP_961135   210 GYGVEFDKLIDlheqivpeidkisdmlVRAGAEHVLDri-------------------------------kPGEPLPADA 258 Mycobacterium av...
ZP_01277086 161 DPMLYIRAIVRiv------------asTRHNVDTLAGvvadalqeciearfg----rdrtpdplemhrmvqDYRELANRL 224 Mycobacterium sp...
ZP_01205727 159 DQLLYVRALLRfv------------eaAEDSVDDLAEafvtslgelyharvgad-ylprpdevdeirqvvqDYRALGEKV 225 Mycobacterium va...
YP_119072   156 GDGIDLATMIDly------------adLRAKLEDVARtlvvaaknrivddhgpgwlpdtdaetaattqmltRWRELGTRI 223 Nocardia farcini...
NP_627389   148 REGIPLGEVLQag------------vrVREHADALAElfadlilr------------------hapepelhRLRPLARSV 197 Streptomyces coe...
ZP_00968290 172 PQRHPAGGAARs---------------TRRVAQRHRAsgggnrppd-----------------rhppggrpRHRPAARGA 219 Pseudomonas aeru...
Feature 1                
YP_290389   217 VDAILAQAM 225 Thermobifida fusca YX
NP_521201   216 VEVELMRAL 224 Ralstonia solanacearum GMI1000
YP_702067   217 VQSLFEEAM 225 Rhodococcus sp. RHA1
NP_825431   219 VDAELARAM 227 Streptomyces avermitilis MA-4680
NP_961135   259 EIAELITML 267 Mycobacterium avium subsp. paratuberculosis K-10
ZP_01277086 225 VARHLDEAL 233 Mycobacterium sp. JLS
ZP_01205727 226 MVARFDQAT 234 Mycobacterium vanbaalenii PYR-1
YP_119072   224 VHSGLEQAL 232 Nocardia farcinica IFM 10152
NP_627389   198 VEAELSLAL 206 Streptomyces coelicolor A3(2)
ZP_00968290 220 GPAGAGQGV 228 Pseudomonas aeruginosa C3719

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap