Conserved Protein Domain Family

cd04776: HTH_GnyR 
Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR
Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
PSSM-Id: 133403
Aligned: 36 rows
Threshold Bit Score: 120.328
Threshold Setting Gi: 11498281
Created: 13-Nov-2006
Updated: 2-Oct-2020
Aligned Rows:
DNA bindingputative dimer
Feature 1:DNA binding residues [nucleic acid binding site]
  • Comment:Based on sequence similarity to BmrR and the structure of Bacillus subtilis BmrR bound to DNA (1EXI).

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1        ###             #                ###                                           
Feature 1                                                
YP_616584   110 RQVTIEKCEERIALLRRQRDDIDSAVDELSRFIEMVKKVDA 150 Sphingopyxis alaskensis RB2256
YP_033441    82 LKELIAGVNKKRADLQQMQRDIDDFLHDLERIEETLFESLA 122 Bartonella henselae str. Houston-1
ZP_00631282 123 TEATLATARDRLADMERQHRELGEAIAELRQQIAEGEASLQ 163 Paracoccus denitrificans PD1222
YP_684108    87 LSRAVEVARDRLDELIQRRDELNDAIADLTDQLKWGEDMVA 127 Roseobacter denitrificans OCh 114

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap