Conserved Protein Domain Family
HTH_TioE_rpt2

?
cd04773: HTH_TioE_rpt2 
Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE
Putative helix-turn-helix (HTH) regulatory protein, TioE, and related proteins. TioE is part of the thiocoraline gene cluster, which is involved in the biosynthesis of the antitumor thiocoraline from the marine actinomycete, Micromonospora. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Proteins in this family are unique within the MerR superfamily in that they are composed of just two adjacent MerR-like N-terminal domains; this CD mainly contains the C-terminal or second repeat (rpt2) of these tandem MerR-like domain proteins.
Statistics
?
PSSM-Id: 133400
View PSSM: cd04773
Aligned: 11 rows
Threshold Bit Score: 122.471
Threshold Setting Gi: 62424111
Created: 8-Nov-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
DNA bindingputative dimer
Feature 1:DNA binding residues [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to BmrR and the structure of Bacillus subtilis BmrR bound to DNA (1EXI).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        ###             #                  ###                                         
CAJ34361    124 YSIGELAHRLGVNVATIRKWETSGVLAPVRRPe--tGHRMYDaSDVRDAELAHFLRRGRYPLELIATVVQQVraagdtqa 201 Micromonospora s...
NP_628643   130 LRIGEVAALVGVRTSALRVWEAAGLLVPGREHg--tGYRVYGpADVRDARVVRTLRRSHHLFEQIRPVLEDLrragsgaa 207 Streptomyces coe...
NP_821259   140 TFIGPLAHKLGIRPATLRTWERAGLVRPRRDPl--tGYRVYDeADVRDARLAHQLRRGGYLLEQIAPLIARVraagglep 217 Streptomyces ave...
YP_177270   122 MTIGEAATLTEVPPSAIRHWEKEGLIHPGRHPe--nGYRLFTpMHIRQILLIRTMRRTVYFLENIKKVVHALehhn-vee 198 Bacillus clausii...
YP_700217   127 MSVSELAAALGIRPSTLRHWDAEGLVVPDRDTp--tGARRYSpSQVRDARVVHQLRKAGYRIAPLHAVMTQLghtpgsgd 204 Rhodococcus sp. ...
NP_244542     1 MTIGEAAELTNVQTSAIRHWEKEGLLSPERNLe--nGYRLYTpVHIRQILLIRTLRKTVYFLDKMKEVVDAVehqs-iek 77  Bacillus halodur...
ZP_01431216 128 ISVGVLARRLGVTPATLRKWERVGILAPARSR----TVRVYSpEDVRDAELAHLLRRGGYLLSHIAAVIEQVhaaggagp 203 Salinispora trop...
ZP_00379262  59 MTITELSQALGVPPSTLRFWEKEGLVSPDRVEarsqTARVYRaTAIRDARITAALRAGGYRIPEVVEAIGALhdlgdasr 138 Brevibacterium l...
ZP_01427849 125 ILVGEAAKAVGVPISALRFWEQQGLLQPIRQAs--nNYRYYDeRQLRRLRIIVLLRQANADFSSIRTTLETLdqqq-pqr 201 Herpetosiphon au...
YP_117567   125 RTIGELAHLLRVTPATLRNWEEAGILSPDRERg--tGFRRYGpSDVRDARLAHLLRRGGYPLERIALVVAQVrtaggtde 202 Nocardia farcini...
BAE98164    152 LSIGELARRLGVTAATLRNWEAVGILSPAREPv--tGHRSFGaTDVRDAELTHLLRRGGYPLEHIRTVIRQIrtaggtea 229 Streptomyces las...
Feature 1                                     
CAJ34361    202 LAAALADWRQRVTTRGLAMLNAAAQLASYL 231 Micromonospora sp. ML1
NP_628643   208 LRAAVEARGRALTVRTRSMLAGAAALHAYL 237 Streptomyces coelicolor A3(2)
NP_821259   218 LEAALRDWHGRLSARGRALLAGAAGLEAYL 247 Streptomyces avermitilis MA-4680
YP_177270   199 AQKMTEQALSTLHQRNRDQFWGIQKLMALC 228 Bacillus clausii KSM-K16
YP_700217   205 IGAALAARDQATTARSRALLDATSALTVLL 234 Rhodococcus sp. RHA1
NP_244542    78 AKKITEEALVSIHQRNRQQFNGVHQMIELC 107 Bacillus halodurans C-125
ZP_01431216 204 LATSIEQWRERITARGRAMLTGSARLADYL 233 Salinispora tropica CNB-440
ZP_00379262 139 SLVALDERLEAVARRTLALFRAGSVLADLV 168 Brevibacterium linens BL2
ZP_01427849 202 AVAAIEQRRVALAQQSWECLQATTALVSYI 231 Herpetosiphon aurantiacus ATCC 23779
YP_117567   203 LADALAQWHGRLLAQGTAMLDAAAKVGEYL 232 Nocardia farcinica IFM 10152
BAE98164    230 LSDALDDWRRRLTVRGVSMLDAAARLGGYV 259 Streptomyces lasaliensis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap