Conserved Protein Domain Family

cd04190: Chitin_synth_C 
C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin.
Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
PSSM-Id: 133033
Aligned: 18 rows
Threshold Bit Score: 250.688
Threshold Setting Gi: 118400291
Created: 10-Nov-2008
Updated: 2-Oct-2020
Aligned Rows:
Ligand bindingDXD motif
Feature 1:Ligand binding site
  • Comment:Predicted ligand binding site based on similar proteins.

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1            # #                                                                          
CAA91105      192 IAITMYNEdeVLFARTMHSVMknishlctrkns------qvwgkdawkkvVVCIISDGRTKihprtlaylaaigvyqdgi 265  fission yeast
XP_001032468  102 ICITMYNEarKELESSLDGILrnmkhfkkn------------lgiqneeiVVVVIYDGIDKinnekdpddnmieyfklwd 169  Tetrahymena t...
P14180        294 ICITMYNEdkYSLARTIHSIMknvahlckreks------hvwgpngwkkvSVILISDGRAKvnqgsldylaalgvyqedm 367  baker's yeast
P30601        258 IVVTMYNEdeFLFARTMIGVFkniefmcnrsss------ktwgkeawkkiVVCIVSDGRAKinprtravlaglgvyqdgi 331  Exophiala der...
XP_001010698  126 VCVTMYSEdrHFLEQTLLHIQknlkgfke-------------lgvsdfqvVVAVIYDGIMKtkkevvdfylelerednld 192  Tetrahymena t...
CAB96110      201 IAVTSYNEdkTLYARTLHGVMlnirdicktkqskywrrhaeegtpgwqkiTVALIVDGLEPmdktvldilatigvyqdgv 280  common mushroom
BAF73720     1335 VCATMWHEtrQEMTQLLKSLFrldyvhcasklaq---ekfrindpdffnlELHVIFDDAFEldekvdkyipnsfvkqlve 1411 Pinctada fucata
EEA75713      521 ICTTMYREtwDEMSKYLDSIKrvatsdldklvg------tkpnnrwagkfEAHVYFDNGLRgdkltdfsaqlvclvkdky 594  Florida lancelet
NP_524209     569 VCATMWHEteDEMMEFLKSIVrldedqcarrmart-hlnggkaddeyyelETNIFFDDAFVsdprqcqnkrnppineyvk 647  fruit fly
AAW19636       83 VCATMYHEnqKEMERLLESFTkldske-----------------eskghvYFCIVFDDACRtegttlhcnlfvdqlvrll 145  Entamoeba inv...
Feature 1                                                                                         
CAA91105      266 aknqvndkevkahi------------------------------------------------------------------ 279  fission yeast
XP_001032468  170 rvegskyhnsnftiprkyekfkeqlerskyqveqlrnddfkifkqneklneeyikykstitddvrqedakkadflysvkq 249  Tetrahymena t...
P14180        368 akasvngdpvkah------------------------------------------------------------------- 380  baker's yeast
P30601        332 akqqvngkdvtahiy----------------------------------------------------------------- 346  Exophiala der...
XP_001010698  193 vhrnlrlrreviqnqidfldfqnqsylldaneglp--------------------------------------------- 227  Tetrahymena t...
CAB96110      281 mkkqvdgkdtvahife---------------------------------------------------------------- 296  common mushroom
BAF73720     1412 cmedaarsvvkgpis----------------------------------------------------------------- 1426 Pinctada fucata
EEA75713      595 pdsvevtprr---------------------------------------------------------------------- 604  Florida lancelet
NP_524209     648 tltrtidkaafevygvn--------------------------------------------------------------- 664  fruit fly
AAW19636      146 qqerikley----------------------------------------------------------------------- 154  Entamoeba inv...
Feature 1                                                                                         
CAA91105      280 ---------------------yeyttqlsidpnlkfkgsdrgivpvqmifclkeKNQKKLNSHLWFFQAFcpil------ 332  fission yeast
XP_001032468  250 kaqkyidsksnnailyqmreriskvvdqnqeqeksssandetedylhifhcikyKNGGKLSSHLWFFCGFcelf------ 323  Tetrahymena t...
P14180        381 ----------------------ifelttqvsinadldyvskdivpvqlvfclkeENKKKINSHRWLFNAFcpvl------ 432  baker's yeast
P30601        347 ---------------------eyttqvglelkgtqvslkprsatpvqllfclkeKNQKKINSHRWFFQAFgrvl------ 399  Exophiala der...
XP_001010698  228 ptipqqisllyqnrfqlklqdqnnrnskvqiispqdddfnqnepalivfslfkhKNAKKLSSHLWFFEGLcrqt------ 301  Tetrahymena t...
CAB96110      297 -------------------yttqlsvdatpqlvlpraedpnnlvpvqiifvlkaQNQKKINSHRWLFNAIgrml------ 351  common mushroom
BAF73720     1427 --------------------llppekvatpyggkliwtmpghtklvvhmkdknkMRHRKRWSQCMYMYYLlgyklfgake 1486 Pinctada fucata
EEA75713      605 --------------------------twygwklrwdlsgslflpltihlkdnqnVKSKKRWSQVMYMESAvdsqrik--- 655  Florida lancelet
NP_524209     665 ------------------irikpplkietpyggrlvwtlpgrtkmvahlknkdkIRHKKRWSQVMYMYYLlgyrimetke 726  fruit fly
AAW19636      155 --------------------------etqwfgavafgtfknttpitvflkdsskIKRNKRYSQLVLFNYAqrilp----- 203  Entamoeba inv...
Feature 1                                                                   #                     
CAA91105      333 ------------------------------------------------kpeVCILLDAGTrpgdqsiyhl--wksfdlnp 362  fission yeast
XP_001032468  324 ------------------------------------------------qpeHTILLDCGLipdetalvnm--ylaletdk 353  Tetrahymena t...
P14180        433 ------------------------------------------------qptVVTLVDVGTrlnntaiyrl--wkvfdmds 462  baker's yeast
P30601        400 ------------------------------------------------dpnICVLIDAGTkpgkdsiyql--wkafdlep 429  Exophiala der...
XP_001010698  302 ------------------------------------------------rpkYVCFVDVGTlpceygivqf--ykamegnl 331  Tetrahymena t...
CAB96110      352 ------------------------------------------------npeICVLIDAGTkpghksiyyl--weafyndp 381  common mushroom
BAF73720     1487 adnymmedaessmtklknrkkgkskktqrsrplrslfmrmtpeqyeqadntFILTLDGDVdfkpdsvkll--idrmkknk 1564 Pinctada fucata
EEA75713      656 --------------------------------------------eskkrvkYILATDGDVdfdagsivamllqmlsdreg 691  Florida lancelet
NP_524209     727 ls--------------------------------------prrkaviaentFILALDGDIdfqpravrll--idrmkavd 766  fruit fly
AAW19636      204 -----------------------------------------------mkntFVLFTDGDTyfspssvekl--cleisaep 234  Entamoeba inv...
Feature 1                                                                                         
CAA91105      363 qVAGACGEIVVMKgklg-------------------------------sgliNPLVATQNFEYKMsnildkpvesvfGFI 411  fission yeast
XP_001032468  354 dIGGVCGFMGIKLqnvynesgertdnfd----------ekqvdwisqlyeetFSIQKAQMFEYNMghlidkpfeslfGFI 423  Tetrahymena t...
P14180        463 nVAGAAGQIKTMKgkwg-------------------------------lklfNPLVASQNFEYKIsnildkplesvfGYI 511  baker's yeast
P30601        430 mCGGACGEIKVMLdhgk--------------------------------kllNPLVATQNFEYKMsnildkplesafGFI 477  Exophiala der...
XP_001010698  332 nIGGVCGFLGLEEppegeqnnekneqtqyinkflnklgsllalflekfldifSSLRLAQVYEYATghiidknfdsflGFL 411  Tetrahymena t...
CAB96110      382 hLGGCCGEIHAMIkggk--------------------------------kllNPLVAAQNFEYKMsnildkplessfGYV 429  common mushroom
BAF73720     1565 kVGAVCGRIHPIGs--------------------------------------GPMVWYQQFEYAVghwlqkaaehvfGCV 1606 Pinctada fucata
EEA75713      692 qVGAVCARTHPVGs--------------------------------------GPFVWYQMFDYAIghwlqkvanhvlGSV 733  Florida lancelet
NP_524209     767 eLGAACGRIHPVGr--------------------------------------GPMVWYQRFEYAIghwlqkatehviGCV 808  fruit fly
AAW19636      235 rCGAISGRVFPDGk--------------------------------------GIWAQYQQFEYATshwlqktaeeelGTV 276  Entamoeba inv...
Feature 1                                                                                         
CAA91105      412 SVLPGAFSAYRFEALQndsqgngplasyf---kgelqntgksgiFEANMYLAEDRILCFELVSKKNEawilhyvksAYAD 488  fission yeast
XP_001032468  424 QVLPGAFSGYRWEALKrdndgnsilddyl---asvldkeqeltlEQQNMNLAEDRILCLKIFSKKGKkytlryirnATAR 500  Tetrahymena t...
P14180        512 SVLPGALSAYRYRALKnhedgtgplrsyf---lgetqegrdhdvFTANMYLAEDRILCWELVAKRDAkwvlkyvkeATGE 588  baker's yeast
P30601        478 SVLPGAFCAYRYVALQndkngvgpleky----fkgetmhadagvFTANMYLAEDRILCFELVSKRNCrwilqyvksATGE 553  Exophiala der...
XP_001010698  412 HVLPGAWSAYRYDALElrydqksnfmqdsyfksvlnpdlltddiKEANKFLAEDRILCLGIISAKGSnyqlkylpdAYAV 491  Tetrahymena t...
CAB96110      430 SVLPGAFSAYRFQAITgcpleqyfhgdhsladrlgpkgiygmniFTKNMFLAEDRILCFELVAKAKDrwtltyvkpSKAE 509  common mushroom
BAF73720     1607 LCCPGCFSLFRGSAVMddnvmkmy------------ttkptearHYIQFEQGEDRWLCTLMLQQGHRidy---cagADAL 1671 Pinctada fucata
EEA75713      734 LCAPGCFTVYRVEAIKkvleeyr--------------sdveeasDFLTKDMGEDRWFTTLLVKAGYKiny---cagAVDS 796  Florida lancelet
NP_524209     809 LCSPGCFSLFRASALMensvmkry------------tmisseamKMVQYDQGEDRWLCTLLLKAGSRvey---caaSDAY 873  fruit fly
AAW19636      277 LCCPGCFTLVRLESVFdvsmkdinvfe-------kyceqpksgmGVLTHNFGEDRWMSYLLVERGWWlky---csiTKSK 346  Entamoeba inv...
Feature 1                                 
CAA91105      489 TDVPdripefvlQRRRWLNGSFFA 512  fission yeast
XP_001032468  501 VDPVtdlvtlvgQRRRWINGSYFA 524  Tetrahymena thermophila SB210
P14180        589 TDVPedvsefisQRRRWLNGAMFA 612  baker's yeast
P30601        554 TDVPdripefvlQRRRWLNGSFFA 577  Exophiala dermatitidis
XP_001010698  492 TDSPetleefihQRRRWTNSMIFA 515  Tetrahymena thermophila SB210
CAB96110      510 TDVPesaaeligQRRRWLNGSFAA 533  common mushroom
BAF73720     1672 TFAPetfneffnQRRRWSPSTLAN 1695 Pinctada fucata
EEA75713      797 THCPeefdefwkQRRRWIPSTLAN 820  Florida lancelet
NP_524209     874 THAPesfnefynQRRRWVPSTIAN 897  fruit fly
AAW19636      347 SFCPtttmeffnQRRRWLTSTWAN 370  Entamoeba invadens

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap