Conserved Protein Domain Family
RSR1

?
cd04177: RSR1 
RSR1/Bud1p family GTPase
RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Statistics
?
PSSM-Id: 133377
View PSSM: cd04177
Aligned: 5 rows
Threshold Bit Score: 297.087
Threshold Setting Gi: 71008203
Created: 20-Mar-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on sequence similarity to Ras, bound to Mg2+/GTP analog

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #######                                      #  #                      
P13856      3 DYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFTAMRELYIKSGMGFLLVY 82  baker's yeast
BAA32410   12 EFHIVVLGTGGVGKSCLTAQFVHNEWIESYDPTIEDSYRTQVAVDGRQVILEILDTAGTEQFVAMRDLYMKAGQGFLLVF 91  Neurospora crassa
CAG78588    3 DYKIVVLGAGGVGKSAITVQYVQDIFIESYDPTIEDSYCKKVNLDGRHCTMEILDTAGVEQFTAMRELYIRNGEGFVLVY 82  Yarrowia lipolytic...
P52498      3 DYKVVVLGAGGVGKSSITVQFVQGVYVESYDPTIEDSYRKQIEVDGRACDLEILDTAGVAQFTAMRELYIKSGKGFLLVY 82  Candida albicans
XP_758194 146 ESRVVIMGGGGVGKSALTVQFVRNVFVSTYDPTIEDTYRKLLVIDGQQCMVEILDTAGTEQFLALKELYIKSGQGFILVF 225 Ustilago maydis 521
Feature 1                                      ## #                           ##              
P13856     83 SVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLINERVISVEEGIEVSSKWgrVPFYETSALLRSNVDEVFVDLV 162 baker's yeast
BAA32410   92 SITSQASLDELATLREEIIRIKDDENIPIVMVGNKADLLDQRAVDRAKAFTISQQWn-APYYEASARTRTNVDEVFIDLC 170 Neurospora crassa
CAG78588   83 SVNSESSLRELQELRQQVCRIKDNNNVPMVLVGNKCDLENERQVQPRDGVALANQWgkVPFYETSAKFKTNIDQVFQDLL 162 Yarrowia lipolytic...
P52498     83 SVTDENSLKELLALREQVLRIKDSDNVPMVLVGNKCDLEDDRVLSIEDGVKVSQDWglVPFYETSAMYKTNVDEAFIDVV 162 Candida albicans
XP_758194 226 SLTSLASVNELGPLREAIVRIKDTTAIPIVLVGNKADLRADRQVPREVGTSLSKAWgnVPYYEASARKRINVDEVFADAV 305 Ustilago maydis 521
Feature 1                                                                                     
P13856    163 RQIIrnemesvavkdarnqsqqfskiespstrlpssakqdtkqsnnkqsskglynkssqgqakvkqstpvnekhkpshav 242 baker's yeast
BAA32410  171 RQMLrrddsgqlddddgarngsgygygq---------------------------------------------------- 198 Neurospora crassa
CAG78588  163 RQIIrrdssfggstvslagtsgmgvsspthsptsstgadylnmpyd------------------draskhvsvkstssaa 224 Yarrowia lipolytic...
P52498    163 RQIMrkeaaisaekkqqkelqkqqqqqqqeqdaegqqqqqksg------------------------kskssatqkdata 218 Candida albicans
XP_758194 306 RQIRafdaingkpsnghsvrhtfastgsv--------------------------------------------------- 334 Ustilago maydis 521
Feature 1                                   
P13856    243 pksgssnrtgisatsqqkkkkknastCTIL 272 baker's yeast
BAA32410  199 ---gkqedghgpmkkkrrrkrkgdhkCIIM 225 Neurospora crassa
CAG78588  225 sirnistsfkghqrknsevkkkkkkgCVIM 254 Yarrowia lipolytica CLIB99
P52498    219 dgqtdvnarlkqsindhpksssgskfCTII 248 Candida albicans
XP_758194 335 --nstkdakmaantfgaasrsrdrkkCVIM 362 Ustilago maydis 521

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap