1KAO


Conserved Protein Domain Family
Rap2

?
cd04176: Rap2 
Click on image for an interactive view with Cn3D
Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c
The Rap2 subgroup is part of the Rap subfamily of the Ras family. It consists of Rap2a, Rap2b, and Rap2c. Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton. In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments. In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway. The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis. Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation. A number of additional effector proteins for Rap2 have been identified, including the RalGEFs RalGDS, RGL, and Rlf, which also interact with Rap1 and Ras. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 133376
View PSSM: cd04176
Aligned: 6 rows
Threshold Bit Score: 290.97
Threshold Setting Gi: 157831586
Created: 20-Mar-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               ######         ####                                                   
1KAO_A      3 EYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVY 82  human
CAB02777    3 EFKVVVLGSGGVGKSALTVQFVSSTFIEKYDPTIEDFYRKEIEVDGQPSVLEILDTAGTEQFSSMRDLYIKNGQGFVVVY 82  nematode
CAG31398    3 EYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVY 82  chicken
AAP06098    4 KYQLVVLGSGGVGKSALTVKFVSGKFVEKYDPTIEDFYRKDILVDGVHHTLEILDTAGTEQFSSLRDLYIRNGQCFLVVY 83  Schistosoma japonicum
AAF47155    3 EFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFASMRDLYIKNGHGFIVMY 82  fruit fly
AAH45215    3 EYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVY 82  African clawed frog
Feature 1                                           ## #                            ##        
1KAO_A     83 SLVNQQSFQDIKPMRDQIIRVKRy-----EKVPVILVGNKVDLES--EREVSSSEGRALAEEWGCPFMETSAKSKTMVDE 155 human
CAB02777   83 SITSQQTFHDIRNMKEQIVRVKGs-----ENVPILLVGNKCDLSH--QRQVRSEEGLALAESWSCPFTECSAKNNQNVNV 155 nematode
CAG31398   83 SLVNQQSFQDIKPMRDQIVRVKRy-----EKVPLILVGNKVDLES--EREVLVAEGRALAQEWGCPFMETSAKSKTMVDE 155 chicken
AAP06098   84 NLASRQTFSDIRNMRDNILRVKGlqpgsvKSVPIVLVGNKADLALngHREIDPQESETLAAQWCCPHLETSARDDVGVNE 163 Schistosoma japonicum
AAF47155   83 SLTNHQTFQDISSMKNVITRVKGs-----QPAPILLVANKFDLDC--QREVSTAEGNALAQLWDCPFIEASAKDRINVNE 155 fruit fly
AAH45215   83 SLVNQQSFQDIKPMRDQIIRVKRy-----EKVPVILVGNKVDLES--EREVSSNEGRALAEDWGCPFMETSAKSKTMVDE 155 African clawed frog
Feature 1               
1KAO_A    156 LFAEIVRQMN 165 human
CAB02777  156 TFAEIVREMN 165 nematode
CAG31398  156 LLLRSSDKLN 165 chicken
AAP06098  164 AFLEAVRQLL 173 Schistosoma japonicum
AAF47155  156 VFATIVREMN 165 fruit fly
AAH45215  156 LFAEIVRQMN 165 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap