Conserved Protein Domain Family
ARLTS1

?
cd04156: ARLTS1 
Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11)
ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling. ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers. ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL). ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter. In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity. In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation. The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in high-risk familial breast cancer.
Statistics
?
PSSM-Id: 133356
View PSSM: cd04156
Aligned: 6 rows
Threshold Bit Score: 264.277
Threshold Setting Gi: 47228243
Created: 1-Sep-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on alignment to Arl2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            #######              ##                         #                        
CAG07638   12 QVLLLGLDNAGKSTLLYKLKHDAFVTTSPTIGFNVEMLDAKKYrknIALTVWDVGGQGKMREHWKSFHNDVAAVVFVVDS 91  Tetraodon nigrovir...
AAH89738   15 RILILGLDDAGKSTVLYKFKFKEPFITIPTVGFNVEMIHTEKH---LQLTMWDVGGQQKLRSFWCHYFENTDGLVYVVDS 91  western clawed frog
NP_612459  14 QVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGH---VSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDS 90  human
AAH45903   14 QVLIMGLDSAGKSTLMYRQLHGVIMQTSPTVGFNVATLQLNKK---TSLTVWDIGGQDTMRPNWKYYLEGCKVLVFVVDS 90  zebrafish
AAH34354   15 QVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERN---FSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDS 91  human
BAB31311   15 HILLLGLDSAGKSTLLYRLKFAETLSTIPTIGFNVEMVQLQSS---LTLTVWDVGGQEKMRTVWDCYCENAQGLMYVVDC 91  house mouse
Feature 1                                     ## #                              ###           
CAG07638   92 SDRe-RLDEAHRELENTLRSEQLRGRPLILLANKQDVNGALTVTEISERFHLRKICAsRDWFVQPCSATAGSGVEEAFKR 170 Tetraodon nigrovir...
AAH89738   92 NDSk-HLDESKKEFQHVLQNELIKDVPVVLLANKQDLPGALNAEEITRKFNMKKYCSdRDWYVQPCCAHTGQGLAEGLSK 170 western clawed frog
NP_612459  91 TDEa-RLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQD-HCWELRGCSALTGEGLPEALQS 168 human
AAH45903   91 SDYa-RIGEAQKALKKILHDEHLKGVPLMVLANKKDLPNTMTIREVSTKLDLDTYTD-RQWEIQACSAVKGLGLQQAFLS 168 zebrafish
AAH34354   92 TDKq-RLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSdRNWYVQPCCALTGEGLAQGFRK 170 human
BAB31311   92 SEGkkRLEDSRKEFKHILKNEHIKNTPVVILANKQDLPGALSAEDITRMFKVKKLCSnRNWYVQPCCAVTGEGLDDGFRK 171 house mouse
Feature 1         
CAG07638  171 VAQM 174 Tetraodon nigroviridis
AAH89738  171 VTEF 174 western clawed frog
NP_612459 169 LWSL 172 human
AAH45903  169 IAKL 172 zebrafish
AAH34354  171 LTGF 174 human
BAB31311  172 LPSF 175 house mouse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap