1X1R,2ERY,2FN4


Conserved Protein Domain Family
M_R_Ras_like

?
cd04145: M_R_Ras_like 
Click on image for an interactive view with Cn3D
R-Ras2/TC21, M-Ras/R-Ras3
The M-Ras/R-Ras-like subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells. It interacts with some of the known Ras effectors, but appears to also have its own effectors. Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts. Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum. In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras. TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 133345
View PSSM: cd04145
Aligned: 13 rows
Threshold Bit Score: 294.7
Threshold Setting Gi: 88193084
Created: 17-Sep-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   ######           ##                                                  
1X1R_A        12 PTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIV 91  house mouse
2ERY_B         4 EKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLV 83  human
2FN4_A         8 ETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLV 87  human
AAW25576      16 PFYKIVILGDGGVGKSALTIQYFQRLFLEEHDPTIEDSYIQNQQIDNEWCVLDVLDTAGQEEFSAMREQYMRKGQGFIIV 95  Schistosoma jap...
CAA84796      16 PYYKLVVIGDGGVGKSSLTIQFFQKQFVDYYDPTIEDQYIQHCEIDGNWVIMDVLDTAGQEEFSAMREQYIRGGRGFLLV 95  nematode
NP_001005931   5 ERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDILDTAGQEEFGAMREQYMRSGEGFLLV 84  zebrafish
NP_001006466  12 EKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAARLDILDTAGQEEFGAMREQYMRTGEGFLLV 91  chicken
AAH72861      12 PTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIV 91  African clawed ...
AAR22928      12 PTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIV 91  chicken
T32953        16 AVLRIVVVGGGGVGKSALTIQFIQRYFVQDYDPTIEDSYTKQCFVDEDLCKLEILDTAGQEEFSTMREQYLRTGSGFLIV 95  nematode
CAA50187       7 RQYKLVVVGGGGVGKSALTIQFIQSHFVQDYDPTIEDSYRKQCVIDDKVAHLDILDTAGQEEFSAMRDEYMRTGEGFLLV 86  Hydra magnipapi...
AAH73313       7 EKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDYRAARLDILDTAGQEEFGAMREQYMRTGEGFLLV 86  African clawed ...
AAM50995       4 QTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMREQYMRSGEGFLLV 83  fruit fly
Feature 1                                          ## #                          ##              
1X1R_A        92 YSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDpPLNVDKTFHDL 171 house mouse
2ERY_B        84 FSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKI-RMNVDQAFHEL 162 human
2FN4_A        88 FAINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKL-RLNVDEAFEQL 166 human
AAW25576      96 YSVTDPQSFNQVRRFHTQILQCKNCNTFPIILAANKIDLVQQRKVSEEEGQCLANDLEVPYIETSAKDpPVNVDKMFHDM 175 Schistosoma jap...
CAA84796      96 FSVTERKSFEEAHKLYNQVLRVKDRSEYPVLLVANKVDLINQRVVSEQEGRELAAQLKLMYIETSAKEpPVNVDAAFHEL 175 nematode
NP_001005931  85 FALNDSGSYNEIQKFHTQILRVKDRDDFPMVLVGNKSDLDQQRVISKEEAMTFARENRIHYMESSAKN-RHNVDEAFMEV 163 zebrafish
NP_001006466  92 FSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKI-RLNVDQAFHEL 170 chicken
AAH72861      92 YSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLIHLRKVSSEQGKEMATKHNIPYIETSAKDpPQNVDKAFHDL 171 African clawed ...
AAR22928      92 YSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQGREMATKHNIPYIETSAKDpPLNVDKAFHDL 171 chicken
T32953        96 FAVTDRNSFEEVKKLHELICRIKDRDDFPIILVGNKADLENERHVARHEAEELAHRLSIPYLECSAKI-RKNVDEAFFDI 174 nematode
CAA50187      87 FSVTDRSSFDEIPRFHTQILRVKDIEEFPMILVGNKSDLENERTVSTAEAQELGRKLKVSYLESSAKQ-RINVDAAFHDL 165 Hydra magnipapi...
AAH73313      87 FSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLEHQRQVTQEEGQQLARQLKVTYIEASAKI-RMNVDQAFHEL 165 African clawed ...
AAM50995      84 FALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQNTSRNLMIPYIECSAKL-RVNVDQAFHEL 162 fruit fly
Feature 1             
1X1R_A       172 VRVIR 176 house mouse
2ERY_B       163 VRVIR 167 human
2FN4_A       167 VRAVR 171 human
AAW25576     176 VRIIR 180 Schistosoma japonicum
CAA84796     176 VRIVR 180 nematode
NP_001005931 164 VRAIR 168 zebrafish
NP_001006466 171 VRVIR 175 chicken
AAH72861     172 VRVIR 176 African clawed frog
AAR22928     172 VRVIR 176 chicken
T32953       175 VRLVS 179 nematode
CAA50187     166 VRAIR 170 Hydra magnipapillata
AAH73313     166 VRVVR 170 African clawed frog
AAM50995     163 VRIVR 167 fruit fly

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap