Conserved Protein Domain Family
Ras2

?
cd04144: Ras2 
Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases)
The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis. In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family. Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Statistics
?
PSSM-Id: 133344
View PSSM: cd04144
Aligned: 5 rows
Threshold Bit Score: 343.752
Threshold Setting Gi: 49646864
Created: 17-Sep-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on sequence similarity to other members of the Ras family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            #######                                      #  #                        
AAO19639    9 KLVVLGDGGVGKTALTIQLCLNHFVETYDPTIEDSYRKQTVIDDQPCMLEVLDTAGQEEYTALRDQWIREGEGFLLVYSI 88  Ustilago maydis
CAG83251   11 KLIVLGDGGVGKTALTIQLCLNHFVEEYDPTIEDSYRKQVVLDGQTAMLEILDTAGQEEYTALRDQWIRDGEGFILVYSI 90  Yarrowia lipolytic...
AAF73473    5 RVAVLGDGGVGKTALAVQFTLNCFVETYDPTIEDAYRKQLVVDNKMCFVEVIDTAGQEEYATLRDQWVPKGQGFILVYSI 84  Schizophyllum commune
CAC28712   10 KLVVLGDGGVGKTALTIQLCLEHFVETYDPTIEDSYRKQVVIDGQACMLEVLDTAGQEEYTALRDQWIRDGEGFVLVYSI 89  Neurospora crassa
EAL18514    4 KITVLGDGGVGKTAITVQFTMSSFVETYDPTIEDCYRKQWVVDEQPCLLEVLDTAGQEEYTALRDQWIREGEGFLIVYSI 83  Cryptococcus neofo...
Feature 1                                                                      ## #           
AAO19639   89 SARATFERVERFRSQISRVKdqe--------------------------------phTVPIMLVGNKCDKVNEREVSREE 136 Ustilago maydis
CAG83251   91 TSRSSFSRIRTYYEQIQRVKed---------------------------------deGFSVVIVGNKSDRNAERVVSTDD 137 Yarrowia lipolytic...
AAF73473   85 ASRSTFDRLEVFRQSMRRVKr-----------------------------------gDPIFMFVGNKCDKTYEREVSKEE 129 Schizophyllum commune
CAC28712   90 SSRSSFARIKKFHHQIQRVKestsspsaypg---------------ssplaatnpsaPVPIMLVGNKSDRVTEREVSTQE 154 Neurospora crassa
EAL18514   84 TSRPTFERVERIVERVLRVKdesglplpspssndpygsnrstptaagggggggmwaaRVPIVIVGNKKDMFHSREVSTDE 163 Cryptococcus neofo...
Feature 1                    ##                                                               
AAO19639  137 GQALAHRLGCKFIESSAKTCVNVERAYYTVVRMIreqregt--------------------------------------- 177 Ustilago maydis
CAG83251  138 GRALARELNSGFFEASAKLNVNIENAFFDCVRACriqrnggqveqpadtgaaqplvtpgvaaggapvnnqtpapvqkaaq 217 Yarrowia lipolytic...
AAF73473  130 GAQLARQFGCEFIETSAKTAQNVERLFTTLVRALrqtkqieagp------------------------------------ 173 Schizophyllum commune
CAC28712  155 GHALARELGCEFTEASAKTRTNVEKAFYDVVKQLrkqrqqgqstpralpp------------------------------ 204 Neurospora crassa
EAL18514  164 GASLARRLGCEFFEASAKTNSNVEAAFKCLVKKIksakqggva------------------------------------- 206 Cryptococcus neofo...
Feature 1                                              
AAO19639  178 --------------------------vthkkeKKKSKCNIL 192 Ustilago maydis
CAG83251  218 sstnpppaqqsapaqktapaakdkaepkkkkdKKKKKCVIM 258 Yarrowia lipolytica CLIB99
AAF73473  174 -----------------------gggptkpkeKEKRKCIIM 191 Schizophyllum commune
CAC28712  205 ----------------sgnsksekysgtekpkRPRGKCLII 229 Neurospora crassa
EAL18514  207 -----------------------vqaeriggrKKKQKCVVL 224 Cryptococcus neoformans var. neoformans B-3501A

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap